| UniProt ID | EGR1_MOUSE | |
|---|---|---|
| UniProt AC | P08046 | |
| Protein Name | Early growth response protein 1 | |
| Gene Name | Egr1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 533 | |
| Subcellular Localization | Nucleus . Cytoplasm . | |
| Protein Description | Transcriptional regulator. [PubMed: 8336701] | |
| Protein Sequence | MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKAMVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSSSASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPATKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQDLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASPAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQVSSFPSAGVSSSFSTSTGLSDMTATFSPRTIEIC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | KAEMQLMSPLQISDP HHHHHHCCCCCCCCC | 30.93 | 25338131 | |
| 26 | Phosphorylation | PFGSFPHSPTMDNYP CCCCCCCCCCCCCCC | 23.46 | 25338131 | |
| 117 | O-linked_Glycosylation | EKAMVETSYPSQTTR CCCCEECCCCCCCCC | 22.88 | 21606357 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 26 | S | Phosphorylation | Kinase | ERK1 | Q63844 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EGR1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EGR1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| G3BP1_MOUSE | G3bp1 | physical | 18627790 | |
| EGR1_MOUSE | Egr1 | physical | 20211142 | |
| NAB2_MOUSE | Nab2 | physical | 20211142 | |
| SP1_MOUSE | Sp1 | physical | 12569082 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...