UniProt ID | EDN1_HUMAN | |
---|---|---|
UniProt AC | P05305 | |
Protein Name | Endothelin-1 | |
Gene Name | EDN1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization | Secreted. | |
Protein Description | Endothelins are endothelium-derived vasoconstrictor peptides.. | |
Protein Sequence | MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
87 | Phosphorylation | VVPYGLGSPRSKRAL CCCCCCCCHHHHHHH | 23.37 | 20562096 | |
100 | O-linked_Glycosylation | ALENLLPTKATDREN HHHHHCCCCCCCCCC | 33.03 | 55828383 | |
118 | "N6,N6-dimethyllysine" | CASQKDKKCWNFCQA CCCCCCHHHHHHHHH | 55.40 | - | |
118 | Methylation | CASQKDKKCWNFCQA CCCCCCHHHHHHHHH | 55.40 | - | |
127 | "N6,N6-dimethyllysine" | WNFCQAGKELRAEDI HHHHHHCCCCCHHHH | 57.50 | - | |
127 | Methylation | WNFCQAGKELRAEDI HHHHHHCCCCCHHHH | 57.50 | - | |
143 | Ubiquitination | EKDWNNHKKGKDCSK HHCCCCCCCCCCHHH | 66.40 | - | |
144 | Ubiquitination | KDWNNHKKGKDCSKL HCCCCCCCCCCHHHH | 64.74 | - | |
169 | Phosphorylation | RGRKIRRSSEEHLRQ HCCCCCCCCHHHHHH | 32.05 | 28270605 | |
170 | Phosphorylation | GRKIRRSSEEHLRQT CCCCCCCCHHHHHHH | 45.23 | 28270605 | |
177 | Phosphorylation | SEEHLRQTRSETMRN CHHHHHHHHHHHHHH | 29.72 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EDN1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EDN1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EDN1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BAG6_HUMAN | BAG6 | physical | 16169070 | |
CSN6_HUMAN | COPS6 | physical | 16169070 | |
EDN1_HUMAN | EDN1 | physical | 15568807 |
loading...