ECSIT_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ECSIT_MOUSE
• UniProt AC: Q9QZH6
• Protein Name: Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
• Gene Name: Ecsit
• Organism: Mus musculus (Mouse).
• Sequence Length: 435
• Subcellular Localization: Cytoplasm . Nucleus . Mitochondrion.
• Protein Description: Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development.; Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase..
• Protein Sequence: MSWVQVNLLVRSLSRGWGGLCRPALSGTPFAQVSLQALRGLHCSAATHKDEPWLVPRPPEPQRKPIKVPAMHEDLFKPSGNRERDKASFLNAVRSFGAHNVRKRGHVDFIYLALRKMPEFGVERDLSVYNLLLDVFPKEVFRPRNVIQRIFVHYPRQQECGVAVLEQMERHGVMPSAETEFLLIQIFGRKSYPMLKFLRMKLWFTRFKNINPYPVPRDLPQDPLDLAKLGLRHMEPDLSAKVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGPFPLWLRNKCVYYHILRADLPPPEEEKVEEIPEEWELYYPQKLDLEYSRSGWDDYEFDVDEVTEGPVFAMCMAGAHDQATLIKWIQGLQETNPTLAQIPVVFRLARSTGELLTTSRLEGQSPPHSPPKGPEEDDETIQAEQQQGQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
88	Phosphorylation	NRERDKASFLNAVRS CCHHHHHHHHHHHHH	35.69	22871156
94	Methylation	ASFLNAVRSFGAHNV HHHHHHHHHHCCCCH	24.69	-
248	Phosphorylation	KVTVYQMSLPSDSTG EEEEEEECCCCCCCC	22.92	23140645
251	Phosphorylation	VYQMSLPSDSTGMED EEEECCCCCCCCCCC	49.87	23140645
253	Phosphorylation	QMSLPSDSTGMEDPT EECCCCCCCCCCCCC	31.06	23140645
254	Phosphorylation	MSLPSDSTGMEDPTQ ECCCCCCCCCCCCCC	45.60	23140645
260	Phosphorylation	STGMEDPTQPHIVGI CCCCCCCCCCEECEE	68.03	23140645
269	Phosphorylation	PHIVGIQSPDQQAAL CEECEECCHHHHHHH	28.64	23140645
410	Phosphorylation	TSRLEGQSPPHSPPK ECCCCCCCCCCCCCC	51.78	27841257

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ECSIT_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ECSIT_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ECSIT_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRAF6_HUMAN	TRAF6	physical	10465784
TRAF6_MOUSE	Traf6	physical	10465784

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.