UniProt ID | ECSIT_MOUSE | |
---|---|---|
UniProt AC | Q9QZH6 | |
Protein Name | Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial | |
Gene Name | Ecsit | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 435 | |
Subcellular Localization | Cytoplasm . Nucleus . Mitochondrion. | |
Protein Description | Adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in the BMP signaling pathway. Required for normal embryonic development.; Required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase.. | |
Protein Sequence | MSWVQVNLLVRSLSRGWGGLCRPALSGTPFAQVSLQALRGLHCSAATHKDEPWLVPRPPEPQRKPIKVPAMHEDLFKPSGNRERDKASFLNAVRSFGAHNVRKRGHVDFIYLALRKMPEFGVERDLSVYNLLLDVFPKEVFRPRNVIQRIFVHYPRQQECGVAVLEQMERHGVMPSAETEFLLIQIFGRKSYPMLKFLRMKLWFTRFKNINPYPVPRDLPQDPLDLAKLGLRHMEPDLSAKVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGPFPLWLRNKCVYYHILRADLPPPEEEKVEEIPEEWELYYPQKLDLEYSRSGWDDYEFDVDEVTEGPVFAMCMAGAHDQATLIKWIQGLQETNPTLAQIPVVFRLARSTGELLTTSRLEGQSPPHSPPKGPEEDDETIQAEQQQGQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
88 | Phosphorylation | NRERDKASFLNAVRS CCHHHHHHHHHHHHH | 35.69 | 22871156 | |
94 | Methylation | ASFLNAVRSFGAHNV HHHHHHHHHHCCCCH | 24.69 | - | |
248 | Phosphorylation | KVTVYQMSLPSDSTG EEEEEEECCCCCCCC | 22.92 | 23140645 | |
251 | Phosphorylation | VYQMSLPSDSTGMED EEEECCCCCCCCCCC | 49.87 | 23140645 | |
253 | Phosphorylation | QMSLPSDSTGMEDPT EECCCCCCCCCCCCC | 31.06 | 23140645 | |
254 | Phosphorylation | MSLPSDSTGMEDPTQ ECCCCCCCCCCCCCC | 45.60 | 23140645 | |
260 | Phosphorylation | STGMEDPTQPHIVGI CCCCCCCCCCEECEE | 68.03 | 23140645 | |
269 | Phosphorylation | PHIVGIQSPDQQAAL CEECEECCHHHHHHH | 28.64 | 23140645 | |
410 | Phosphorylation | TSRLEGQSPPHSPPK ECCCCCCCCCCCCCC | 51.78 | 27841257 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECSIT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECSIT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECSIT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRAF6_HUMAN | TRAF6 | physical | 10465784 | |
TRAF6_MOUSE | Traf6 | physical | 10465784 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...