| UniProt ID | DPH6_HUMAN | |
|---|---|---|
| UniProt AC | Q7L8W6 | |
| Protein Name | Diphthine--ammonia ligase | |
| Gene Name | DPH6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 267 | |
| Subcellular Localization | ||
| Protein Description | Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor (EEF2) to diphthamide (By similarity).. | |
| Protein Sequence | MRVAALISGGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 87 | Ubiquitination | DTRQVYTKCEGDEVE CHHHHHCCCCCCHHH | 21963094 | ||
| 97 | Phosphorylation | GDEVEDLYELLKLVK CCHHHHHHHHHHHHH | 25147952 | ||
| 101 | Ubiquitination | EDLYELLKLVKEKEE HHHHHHHHHHHCHHH | 21906983 | ||
| 104 | Ubiquitination | YELLKLVKEKEEVEG HHHHHHHHCHHHCCC | 22817900 | ||
| 106 | Ubiquitination | LLKLVKEKEEVEGIS HHHHHHCHHHCCCEE | 22817900 | ||
| 131 | Ubiquitination | IRVENVCKRLNLQPL HHHHHHHHHCCCHHH | - | ||
| 174 | Ubiquitination | ALGLDPDKHLGKTLD HCCCCCCCCCCCCHH | 21890473 | ||
| 178 | Ubiquitination | DPDKHLGKTLDQMEP CCCCCCCCCHHHHHH | 21906983 | ||
| 179 | Phosphorylation | PDKHLGKTLDQMEPY CCCCCCCCHHHHHHH | 18452278 | ||
| 186 | Phosphorylation | TLDQMEPYLIELSKK CHHHHHHHHHHHHHH | 29083192 | ||
| 191 | Phosphorylation | EPYLIELSKKYGVHV HHHHHHHHHHHCEEE | 29083192 | ||
| 192 | Ubiquitination | PYLIELSKKYGVHVC HHHHHHHHHHCEEEC | 22817900 | ||
| 193 | Ubiquitination | YLIELSKKYGVHVCG HHHHHHHHHCEEECC | 22817900 | ||
| 250 | Ubiquitination | LELHLEDKVSSVPDN HHHHHHCCCCCCCCC | - | ||
| 258 | Phosphorylation | VSSVPDNYRTSNYIY CCCCCCCCCCCCCCE | 27642862 | ||
| 260 | Phosphorylation | SVPDNYRTSNYIYNF CCCCCCCCCCCCEEC | 28796482 | ||
| 261 | Phosphorylation | VPDNYRTSNYIYNF- CCCCCCCCCCCEEC- | 28796482 | ||
| 263 | Phosphorylation | DNYRTSNYIYNF--- CCCCCCCCCEEC--- | 28796482 | ||
| 265 | Phosphorylation | YRTSNYIYNF----- CCCCCCCEEC----- | 28796482 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPH6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPH6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPH6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AT2B2_HUMAN | ATP2B2 | physical | 26186194 | |
| MFS4B_HUMAN | KIAA1919 | physical | 26186194 | |
| AT2B2_HUMAN | ATP2B2 | physical | 28514442 | |
| MFS4B_HUMAN | KIAA1919 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
