UniProt ID | DNM3L_MOUSE | |
---|---|---|
UniProt AC | Q9CWR8 | |
Protein Name | DNA (cytosine-5)-methyltransferase 3-like | |
Gene Name | Dnmt3l | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 421 | |
Subcellular Localization | Nucleus . | |
Protein Description | Catalytically inactive regulatory factor of DNA methyltransferases that can either promote or inhibit DNA methylation depending on the context. [PubMed: 11719692] | |
Protein Sequence | MGSRETPSSCSKTLETLDLETSDSSSPDADSPLEEQWLKSSPALKEDSVDVVLEDCKEPLSPSSPPTGREMIRYEVKVNRRSIEDICLCCGTLQVYTRHPLFEGGLCAPCKDKFLESLFLYDDDGHQSYCTICCSGGTLFICESPDCTRCYCFECVDILVGPGTSERINAMACWVCFLCLPFSRSGLLQRRKRWRHQLKAFHDQEGAGPMEIYKTVSAWKRQPVRVLSLFRNIDKVLKSLGFLESGSGSGGGTLKYVEDVTNVVRRDVEKWGPFDLVYGSTQPLGSSCDRCPGWYMFQFHRILQYALPRQESQRPFFWIFMDNLLLTEDDQETTTRFLQTEAVTLQDVRGRDYQNAMRVWSNIPGLKSKHAPLTPKEEEYLQAQVRSRSKLDAPKVDLLVKNCLLPLREYFKYFSQNSLPL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
6 | Phosphorylation | --MGSRETPSSCSKT --CCCCCCCCCCCCE | 27.62 | 22006019 | |
12 | Ubiquitination | ETPSSCSKTLETLDL CCCCCCCCEEEEECC | 62.55 | - | |
13 | Phosphorylation | TPSSCSKTLETLDLE CCCCCCCEEEEECCC | 17.34 | 21149613 | |
16 | Phosphorylation | SCSKTLETLDLETSD CCCCEEEEECCCCCC | 28.78 | 21149613 | |
21 | Phosphorylation | LETLDLETSDSSSPD EEEECCCCCCCCCCC | 45.17 | 21149613 | |
22 | Phosphorylation | ETLDLETSDSSSPDA EEECCCCCCCCCCCC | 26.56 | 21149613 | |
24 | Phosphorylation | LDLETSDSSSPDADS ECCCCCCCCCCCCCC | 32.27 | 21149613 | |
25 | Phosphorylation | DLETSDSSSPDADSP CCCCCCCCCCCCCCC | 51.37 | 21149613 | |
26 | Phosphorylation | LETSDSSSPDADSPL CCCCCCCCCCCCCCH | 30.65 | 21149613 | |
40 | Phosphorylation | LEEQWLKSSPALKED HHHHHHHCCCCCCCC | 39.11 | 22006019 | |
41 | Phosphorylation | EEQWLKSSPALKEDS HHHHHHCCCCCCCCC | 16.77 | 22006019 | |
45 | Ubiquitination | LKSSPALKEDSVDVV HHCCCCCCCCCCCEE | 62.68 | - | |
48 | Phosphorylation | SPALKEDSVDVVLED CCCCCCCCCCEEEEC | 22.70 | 24759943 | |
61 | Phosphorylation | EDCKEPLSPSSPPTG ECCCCCCCCCCCCCC | 33.19 | 21149613 | |
63 | Phosphorylation | CKEPLSPSSPPTGRE CCCCCCCCCCCCCHH | 52.69 | 21149613 | |
64 | Phosphorylation | KEPLSPSSPPTGREM CCCCCCCCCCCCHHC | 37.98 | 24759943 | |
67 | Phosphorylation | LSPSSPPTGREMIRY CCCCCCCCCHHCEEE | 52.86 | 21149613 | |
199 | Ubiquitination | KRWRHQLKAFHDQEG HHHHHHHHHHHCCCC | 42.30 | - | |
239 | Phosphorylation | NIDKVLKSLGFLESG CHHHHHHHCCCCCCC | 29.57 | 22871156 | |
245 | Phosphorylation | KSLGFLESGSGSGGG HHCCCCCCCCCCCCC | 40.17 | 22871156 | |
247 | Phosphorylation | LGFLESGSGSGGGTL CCCCCCCCCCCCCHH | 38.78 | 22006019 | |
255 | Ubiquitination | GSGGGTLKYVEDVTN CCCCCHHEEEEECHH | 47.27 | - | |
261 | Phosphorylation | LKYVEDVTNVVRRDV HEEEEECHHHHHHCH | 34.32 | 22871156 | |
270 | Ubiquitination | VVRRDVEKWGPFDLV HHHHCHHHHCCCCEE | 58.25 | - | |
340 | Phosphorylation | TTTRFLQTEAVTLQD HHHHHHHHEEEEHHH | 28.23 | - | |
376 | Ubiquitination | KHAPLTPKEEEYLQA CCCCCCHHHHHHHHH | 72.95 | - | |
390 | Ubiquitination | AQVRSRSKLDAPKVD HHHHCCCCCCCCHHH | 49.64 | - | |
395 | Acetylation | RSKLDAPKVDLLVKN CCCCCCCHHHHHHHH | 50.53 | 22902405 | |
395 | Ubiquitination | RSKLDAPKVDLLVKN CCCCCCCHHHHHHHH | 50.53 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNM3L_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNM3L_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNM3L_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNM3A_MOUSE | Dnmt3a | physical | 16999741 | |
EHMT2_MOUSE | Ehmt2 | physical | 18953337 | |
DNM3B_MOUSE | Dnmt3b | physical | 16543361 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...