DMRTD_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DMRTD_MOUSE
• UniProt AC: Q8CGW9
• Protein Name: Doublesex- and mab-3-related transcription factor C2
• Gene Name: Dmrtc2
• Organism: Mus musculus (Mouse).
• Sequence Length: 370
• Subcellular Localization: Nucleus .
• Protein Description: May be involved in sexual development..
• Protein Sequence: MDPSETAALHHCSADSSPADEARVPQSTELIPRRPVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKRHLAQGLMKGATPLKAPLRVKKGAIRPGIPSGKENIAPQPQSPHGAVPLVLTPPGKENYGPLLLSRPPEALPLPWTPVPPGPWGPGHWLPPGLSMPPPVVCRLLCQEPAVPLHPFPGFDPGTSLRLPTHGTLPTCPGSRSVLTAPLSGEPQGPPNLPHTCSTLILQSCGTPDSLLLQPQAPGASCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHPCGPPAPPGGRGFQPVGPPLRPSPGSSVSLHIGRLGSISLLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
138	Phosphorylation	NIAPQPQSPHGAVPL CCCCCCCCCCCCCCE	26.08	25293948
148	Phosphorylation	GAVPLVLTPPGKENY CCCCEEECCCCCCCC	21.69	25293948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DMRTD_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DMRTD_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DMRTD_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABTB1_MOUSE	Abtb1	physical	20211142
NS1BP_MOUSE	Ivns1abp	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.