| UniProt ID | DLX4_HUMAN | |
|---|---|---|
| UniProt AC | Q92988 | |
| Protein Name | Homeobox protein DLX-4 | |
| Gene Name | DLX4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 240 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May play a role in determining the production of hemoglobin S. May act as a repressor. During embryonic development, plays a role in palatogenesis.. | |
| Protein Sequence | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTSLPCPLP ------CCCCCCCCC | 38.68 | - | |
| 3 | Phosphorylation | -----MTSLPCPLPG -----CCCCCCCCCC | 29.08 | - | |
| 14 | Phosphorylation | PLPGRDASKAVFPDL CCCCCCHHHHCCCCC | 25.99 | - | |
| 96 | Phosphorylation | PQELEADSEKPRLSP HHHHHCCCCCCCCCC | 55.35 | - | |
| 198 | Phosphorylation | TFSVSPCSPPLPSLW EEEECCCCCCCCCHH | 32.70 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLX4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLX4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLX4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LSM3_HUMAN | LSM3 | physical | 21988832 | |
| GPC6_HUMAN | GPC6 | physical | 28514442 | |
| RRP44_HUMAN | DIS3 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...