UniProt ID | DLX4_HUMAN | |
---|---|---|
UniProt AC | Q92988 | |
Protein Name | Homeobox protein DLX-4 | |
Gene Name | DLX4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 240 | |
Subcellular Localization | Nucleus . | |
Protein Description | May play a role in determining the production of hemoglobin S. May act as a repressor. During embryonic development, plays a role in palatogenesis.. | |
Protein Sequence | MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTSLPCPLP ------CCCCCCCCC | 38.68 | - | |
3 | Phosphorylation | -----MTSLPCPLPG -----CCCCCCCCCC | 29.08 | - | |
14 | Phosphorylation | PLPGRDASKAVFPDL CCCCCCHHHHCCCCC | 25.99 | - | |
96 | Phosphorylation | PQELEADSEKPRLSP HHHHHCCCCCCCCCC | 55.35 | - | |
198 | Phosphorylation | TFSVSPCSPPLPSLW EEEECCCCCCCCCHH | 32.70 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLX4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLX4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLX4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LSM3_HUMAN | LSM3 | physical | 21988832 | |
GPC6_HUMAN | GPC6 | physical | 28514442 | |
RRP44_HUMAN | DIS3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...