UniProt ID | GPC6_HUMAN | |
---|---|---|
UniProt AC | Q9Y625 | |
Protein Name | Glypican-6 | |
Gene Name | GPC6 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 555 | |
Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor Extracellular side. Secreted glypican-6: Secreted, extracellular space. |
|
Protein Description | Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity). Enhances migration and invasion of cancer cells through WNT5A signaling.. | |
Protein Sequence | MPSWIGAVILPLLGLLLSLPAGADVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLSWSLTCIVLALQRLCR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MPSWIGAVIL -----CCCHHHHHHH | 29.99 | - | |
212 | Phosphorylation | RKLKIQVTRAFIAAR HHHHHHHHHHHHHHH | 10.41 | 25278378 | |
220 | Phosphorylation | RAFIAARTFVQGLTV HHHHHHHHHHHCCCC | 24.35 | 23403867 | |
374 | O-linked_Glycosylation | YNPEERPTTAAGTSL CCCCCCCCCCCCCCH | 34.98 | 55826091 | |
375 | O-linked_Glycosylation | NPEERPTTAAGTSLD CCCCCCCCCCCCCHH | 19.72 | OGP | |
411 | Phosphorylation | YTICKDESVTAGTSN CEEECCCCCCCCCCC | 34.60 | - | |
529 | GPI-anchor | PDRREVDSSAAQRGH CCHHHCCCHHHHHCH | 27.35 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPC6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPC6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPC6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GPC6_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...