UniProt ID | DGC6L_HUMAN | |
---|---|---|
UniProt AC | Q9BY27 | |
Protein Name | Protein DGCR6L | |
Gene Name | DGCR6L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 220 | |
Subcellular Localization | Nucleus . Predominantly nuclear. | |
Protein Description | May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.. | |
Protein Sequence | MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | ARQQERHYQLLSALQ HHHHHHHHHHHHHHH | 13.69 | - | |
99 | Ubiquitination | LRQALRQKHQEAQQA HHHHHHHHHHHHHHH | 40.60 | - | |
140 | Ubiquitination | EQRAMDQKIILELDR HHHHHHHHHHHHHHH | 27.70 | - | |
148 | Ubiquitination | IILELDRKVADQQST HHHHHHHHHHHHHHH | 41.25 | 29967540 | |
206 | Phosphorylation | GLGGPWQSPAAQCDQ CCCCCCCCCCHHCCC | 16.79 | 28555341 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DGC6L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DGC6L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DGC6L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KCNRG_HUMAN | KCNRG | physical | 16189514 | |
RIM3A_HUMAN | RIMBP3 | physical | 25416956 | |
DEUP1_HUMAN | CCDC67 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...