DERL1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DERL1_DROME
• UniProt AC: Q9VQ57
• Protein Name: Derlin-1 {ECO:0000305}
• Gene Name: Der-1 {ECO:0000312|FlyBase:FBgn0267972}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 245
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins. May also involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively attenuates the translocation of newly synthesized proteins into the endoplasmic reticulum and reroutes them to the cytosol for proteasomal degradation..
• Protein Sequence: MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVFPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFLMDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSLASLVGIFVGHVYYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGMTLGRN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DERL1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DERL1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DERL1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DERL1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERA_DROME	TER94	genetic	25255315
DRONC_DROME	Nc	genetic	25255315
TERA_DROME	TER94	physical	25255315

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.