UniProt ID | DCR_ARATH | |
---|---|---|
UniProt AC | Q9FF86 | |
Protein Name | BAHD acyltransferase DCR | |
Gene Name | DCR | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 484 | |
Subcellular Localization | Cytoplasm, cytosol . | |
Protein Description | Required for incorporation of 9(10),16-dihydroxy-hexadecanoic acid into cutin.. | |
Protein Sequence | MKIKIMSKTHVKPTKPVLGKKQFHLTTFDLPYLAFYYNQKFLLYKFQNLLDLEEPTFQNEVVENLKDGLGLVLEDFYQLAGKLAKDDEGVFRVEYDAEDSEINGVEFSVAHAADVTVDDLTAEDGTAKFKELVPYNGILNLEGLSRPLLAVQVTKLKDGLAMGLAFNHAVLDGTSTWHFMSSWAEICRGAQSISTQPFLDRSKARDTRVKLDLTAPKDPNETSNGEDAANPTVEPPQLVEKIFRFSDFAVHTIKSRANSVIPSDSSKPFSTFQSLTSHIWRHVTLARGLKPEDITIFTVFADCRRRVDPPMPEEYFGNLIQAIFTGTAAGLLAAHGPEFGASVIQKAIAAHDASVIDARNDEWEKSPKIFQFKDAGVNCVAVGSSPRFRVYEVDFGFGKPETVRSGSNNRFNGMMYLYQGKAGGISIDVEITLEASVMEKLVKSKEFLLSEEEEEDDGKKLTNGNGHVNGNGNGYVNGNGNGFV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
436 | Phosphorylation | VEITLEASVMEKLVK EEEEEEHHHHHHHHH | 16.78 | 26091701 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCR_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCR_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCR_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SUMO3_ARATH | SUMO3 | physical | 20855607 | |
SUMO1_ARATH | SUMO1 | physical | 20855607 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...