dbPTM

DCR_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DCR_ARATH
UniProt AC	Q9FF86
Protein Name	BAHD acyltransferase DCR
Gene Name	DCR
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	484
Subcellular Localization	Cytoplasm, cytosol .
Protein Description	Required for incorporation of 9(10),16-dihydroxy-hexadecanoic acid into cutin..
Protein Sequence	MKIKIMSKTHVKPTKPVLGKKQFHLTTFDLPYLAFYYNQKFLLYKFQNLLDLEEPTFQNEVVENLKDGLGLVLEDFYQLAGKLAKDDEGVFRVEYDAEDSEINGVEFSVAHAADVTVDDLTAEDGTAKFKELVPYNGILNLEGLSRPLLAVQVTKLKDGLAMGLAFNHAVLDGTSTWHFMSSWAEICRGAQSISTQPFLDRSKARDTRVKLDLTAPKDPNETSNGEDAANPTVEPPQLVEKIFRFSDFAVHTIKSRANSVIPSDSSKPFSTFQSLTSHIWRHVTLARGLKPEDITIFTVFADCRRRVDPPMPEEYFGNLIQAIFTGTAAGLLAAHGPEFGASVIQKAIAAHDASVIDARNDEWEKSPKIFQFKDAGVNCVAVGSSPRFRVYEVDFGFGKPETVRSGSNNRFNGMMYLYQGKAGGISIDVEITLEASVMEKLVKSKEFLLSEEEEEDDGKKLTNGNGHVNGNGNGYVNGNGNGFV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
436	Phosphorylation	VEITLEASVMEKLVK EEEEEEHHHHHHHHH	16.78	26091701

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DCR_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DCR_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DCR_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SUMO3_ARATH	SUMO3	physical	20855607
SUMO1_ARATH	SUMO1	physical	20855607

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DCR_ARATH

Related Literatures of Post-Translational Modification