UniProt ID | CV046_HUMAN | |
---|---|---|
UniProt AC | C9J442 | |
Protein Name | Uncharacterized protein C22orf46 | |
Gene Name | C22orf46 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MLLSLLGACAVVGPFHGPEWEPVQGLLSQNHSCRDPQCCGNLLVLCLFLVWQVRHCWHQVTRTRFSTRNVIKVPLQKRAVPSMRCETVFKLTPEFFSPGKSRGLDSQQCAQRQRWGYRRSLQESWAQNLLSPQHPCPGPPSGVHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNLLSAERLQFCPQRAPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | N-linked_Glycosylation | VQGLLSQNHSCRDPQ CCHHHHCCCCCCCCC | 26.18 | UniProtKB CARBOHYD | |
63 | Phosphorylation | CWHQVTRTRFSTRNV HHHHHHCCCCCCCCE | 27.05 | 26074081 | |
66 | Phosphorylation | QVTRTRFSTRNVIKV HHHCCCCCCCCEEEE | 24.14 | 26074081 | |
67 | Phosphorylation | VTRTRFSTRNVIKVP HHCCCCCCCCEEEEE | 24.45 | 26074081 | |
165 | N-linked_Glycosylation | NTCLLPQNSSWKAWQ CCEECCCCCCCCCEE | 35.75 | UniProtKB CARBOHYD | |
224 | Phosphorylation | TSMTLTTSLPNLLSA CCCEEECCCCCCCCH | 36.27 | - | |
230 | Phosphorylation | TSLPNLLSAERLQFC CCCCCCCCHHHHHCC | 31.11 | 20860994 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CV046_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CV046_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CV046_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
K1C40_HUMAN | KRT40 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...