dbPTM

CUFF_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CUFF_DROME
UniProt AC	Q9V629
Protein Name	Protein cutoff
Gene Name	cuff
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	384
Subcellular Localization	Cytoplasm. Chromosome. Localised to perinuclear puncta in the nurse cells of younger egg chambers. Accumulates at centromeric/pericentromeric positions in germ-cell nuclei and strongly colocalizes with the major heterochromatic domains.
Protein Description	Involved in the piRNA pathway in germline. tissues..
Protein Sequence	MNSNYTILNIRAHSWAEKDNLVFPTITKPVSNGWFAWSPIGQFEPNSQKVPYVVVPPSIKFPISLRYKDSPPKLEKKPNIFLDNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTMYICRIDVEQPDPIDQDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFHGVFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHNRTEALKWWVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRMMLDDHTNDMCKTPNLQTMSSIV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CUFF_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CUFF_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CUFF_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CUFF_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DEL_DROME	del	physical	14605208
LOK_DROME	lok	genetic	17363252
XRN2_DROME	Rat1	physical	27292797
DEL_DROME	del	physical	24906153

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CUFF_DROME

Related Literatures of Post-Translational Modification