| UniProt ID | CTG1B_HUMAN | |
|---|---|---|
| UniProt AC | P78358 | |
| Protein Name | Cancer/testis antigen 1 | |
| Gene Name | CTAG1A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 180 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | ||
| Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MQAEGRGTGGSTGDA CCCCCCCCCCCCCCC | 36.69 | 24114839 | |
| 11 | Phosphorylation | EGRGTGGSTGDADGP CCCCCCCCCCCCCCC | 30.48 | 24114839 | |
| 12 | Phosphorylation | GRGTGGSTGDADGPG CCCCCCCCCCCCCCC | 42.21 | 24114839 | |
| 54 | Phosphorylation | GAGAARASGPGGGAP CCCCCCCCCCCCCCC | 39.71 | 20860994 | |
| 91 | Phosphorylation | ESRLLEFYLAMPFAT HHHHHHHHHHCCCCC | 5.56 | 27642862 | |
| 98 | Phosphorylation | YLAMPFATPMEAELA HHHCCCCCHHHHHHH | 24.44 | 20068231 | |
| 108 | Phosphorylation | EAELARRSLAQDAPP HHHHHHHHHCCCCCC | 23.62 | 27499020 | |
| 124 | Ubiquitination | PVPGVLLKEFTVSGN CCCEEEEEEEEEECC | 46.77 | 22817900 | |
| 124 (in isoform 1) | Ubiquitination | - | 46.77 | 21906983 | |
| 134 | Phosphorylation | TVSGNILTIRLTAAD EEECCEEEEEEEHHH | 10.56 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CTG1B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CTG1B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CTG1B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MAGC1_HUMAN | MAGEC1 | physical | 17137291 | |
| UBQL1_HUMAN | UBQLN1 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
