UniProt ID | CTG1B_HUMAN | |
---|---|---|
UniProt AC | P78358 | |
Protein Name | Cancer/testis antigen 1 | |
Gene Name | CTAG1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 180 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MQAEGRGTGGSTGDA CCCCCCCCCCCCCCC | 36.69 | 24114839 | |
11 | Phosphorylation | EGRGTGGSTGDADGP CCCCCCCCCCCCCCC | 30.48 | 24114839 | |
12 | Phosphorylation | GRGTGGSTGDADGPG CCCCCCCCCCCCCCC | 42.21 | 24114839 | |
54 | Phosphorylation | GAGAARASGPGGGAP CCCCCCCCCCCCCCC | 39.71 | 20860994 | |
91 | Phosphorylation | ESRLLEFYLAMPFAT HHHHHHHHHHCCCCC | 5.56 | 27642862 | |
98 | Phosphorylation | YLAMPFATPMEAELA HHHCCCCCHHHHHHH | 24.44 | 20068231 | |
108 | Phosphorylation | EAELARRSLAQDAPP HHHHHHHHHCCCCCC | 23.62 | 27499020 | |
124 | Ubiquitination | PVPGVLLKEFTVSGN CCCEEEEEEEEEECC | 46.77 | 22817900 | |
124 (in isoform 1) | Ubiquitination | - | 46.77 | 21906983 | |
134 | Phosphorylation | TVSGNILTIRLTAAD EEECCEEEEEEEHHH | 10.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CTG1B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CTG1B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CTG1B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAGC1_HUMAN | MAGEC1 | physical | 17137291 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...