CSN5_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CSN5_DROME
• UniProt AC: Q9XZ58
• Protein Name: COP9 signalosome complex subunit 5
• Gene Name: CSN5
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 327
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. The CSN complex plays an essential role in oogenesis and embryogenesis and is required for proper photoreceptor R cell differentiation and promote lamina glial cell migration or axon targeting. It also promotes Ubl-dependent degradation of cyclin E (CycE) during early oogenesis. Also involved in regulation of axis formation by checkpoint-dependent, translational control of Gurken..
• Protein Sequence: MDSDAAQKTWELENNIQTLPSCDEIFRYDAEQQRQIIDAKPWEKDPHFFKDIKISALALLKMVMHARSGGTLEVMGLMLGKVEDNTMIVMDAFALPVEGTETRVNAQAQAYEYMTAYMEAAKEVGRMEHAVGWYHSHPGYGCWLSGIDVSTQMLNQTYQEPFVAIVVDPVRTVSAGKVCLGAFRTYPKGYKPPNEEPSEYQTIPLNKIEDFGVHCKQYYPLEISYFKSALDRRLLDSLWNKYWVNTLGSSGLLTNTEYTTGQIMDLSEKLEQSENFLGRGTDVNEKRSEDKLSKATRDCSRSTIELIHGLMAQIVKDKLFNKVGLGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
300	Phosphorylation	SKATRDCSRSTIELI HHHHHHCCHHHHHHH	33.29	22817900
302	Phosphorylation	ATRDCSRSTIELIHG HHHHCCHHHHHHHHH	19.90	22817900
303	Phosphorylation	TRDCSRSTIELIHGL HHHCCHHHHHHHHHH	19.84	15735686

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CSN5_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CSN5_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CSN5_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN6_DROME	CSN6	physical	14605208
CSN2_DROME	alien	physical	10531038
CSN7_DROME	CSN7	physical	10531038
ATR_DROME	mei-41	genetic	12397113
CCNE_DROME	CycE	genetic	12737805

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of Drosophila melanogaster embryos.";
Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.;
J. Proteome Res. 7:1675-1682(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-300; SER-302 ANDTHR-303, AND MASS SPECTROMETRY.
PubMed: 18327897