UniProt ID | CPY71_ARATH | |
---|---|---|
UniProt AC | Q8W4D0 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase CYP71 | |
Gene Name | CYP71 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 631 | |
Subcellular Localization | Nucleus . | |
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Histone remodeling factor involved in chromatin-based gene silencing. Reinforces H3K27 methylation. Involved in fundamental processes of chromatin assembly and histone modification by mediating the targeting of FAS1 and LHP1 on the chromatin. Required for the formation and development of leaves, for normal phyllotaxy and for the formation, maintenance and activity of root and shoot apical meristems.. | |
Protein Sequence | MEEESKNGGTTIPTEELAVVAVPPVVEEEEPMVGPGPAPRGKRKRPLQFEQAYLDSLPSANMYEKSYMHRDVVTHVAVSAAEFFISGSMDGHLKFWKKKGVGIEFAKHFRSHLGPIEGLAVSIDGLLCCTISNDHAVKIYDVVNYDMMAMIRLPYIPGAVEWVYKQGDVKAKLAVSDRDSLFVHIYDPRSGSNEPIASKEIHMNPIKVMKYNPVSDTMISGDTKGIIEYWSATTLQFPEDEVNFKLKSDTNLFEIIKCKTTISAIEVSPDGKQFSITAPDRRIRVFWFRTGKLRRVYDESLVVAQDLQRSDAPLYRLEAIDFGRRMAVEKELEKTESAPQPNAVFDESSNFLIYATFLGIKVINLHTNTVARILGKVESNERYLRVALYQGDQGGKKVRKIPAAAANVNESKEPLTDPTILCCAFKKHRIYMFSRREPEEPEDASQGRDVFNEKPAADELMSVSDIGNSATTSLPENVIMHTTLGDIHMKLYPEECPKTVENFTTHCRNGYYDNHLFHRVIRGFMIQTGDPLGDGTGGQSIWGREFEDEFHKSLRHDRPFTLSMANAGPNTNGSQFFITTVATPWLDNKHTVFGRVVKGMDVVQGIEKVKTDKNDRPYQDVKILNVTVPKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CPY71_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CPY71_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CPY71_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LHP1_ARATH | TFL2 | physical | 21596687 | |
FAS1_ARATH | FAS1 | physical | 21596687 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...