CPLX_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CPLX_DROME
• UniProt AC: Q8IPM8
• Protein Name: Complexin
• Gene Name: cpx
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 142
• Subcellular Localization: Membrane ; Lipid-anchor .
• Protein Description: Positively regulates a late step in synaptic vesicle exocytosis..
• Protein Sequence: MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	QMVGNQLSAVKGAVG HHHHHHHHHHCCCCC	22.66	27794539
101	Phosphorylation	PLMRKKKTPEELAAE CCCCCCCCHHHHHHH	44.82	27794539
139	Farnesylation	KTQIEGKCVMQ---- HHHHCCCCCCC----	4.53	-
139	Methylation	KTQIEGKCVMQ---- HHHHCCCCCCC----	4.53	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CPLX_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CPLX_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CPLX_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNP25_DROME	Snap25	physical	23769723
STX1A_DROME	Syx1A	physical	23769723

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.