UniProt ID | CP27A_HUMAN | |
---|---|---|
UniProt AC | Q02318 | |
Protein Name | Sterol 26-hydroxylase, mitochondrial | |
Gene Name | CYP27A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 531 | |
Subcellular Localization | Mitochondrion membrane. | |
Protein Description | Catalyzes the first step in the oxidation of the side chain of sterol intermediates; the 27-hydroxylation of 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol. Has also a vitamin D3-25-hydroxylase activity.. | |
Protein Sequence | MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
280 | Phosphorylation | DGWNAIFSFGKKLID HHHHHHHHHHHHHHH | 27.29 | - | |
283 | Acetylation | NAIFSFGKKLIDEKL HHHHHHHHHHHHHHH | 42.25 | - | |
321 | Phosphorylation | LLASGQLSPREAMGS HHHCCCCCHHHHHCC | 17.64 | 20058876 | |
387 | Trimethylation | FAHMPLLKAVLKETL CCCHHHHHHHHHHHH | 44.10 | - | |
387 | Methylation | FAHMPLLKAVLKETL CCCHHHHHHHHHHHH | 44.10 | - | |
391 | Malonylation | PLLKAVLKETLRLYP HHHHHHHHHHHHHCC | 41.89 | 26320211 | |
439 | Phosphorylation | SRDPTAFSEPESFQP ECCCCCCCCCCCCCC | 50.18 | - | |
453 | Phosphorylation | PHRWLRNSQPATPRI CCHHHHCCCCCCCCC | 30.98 | 28176443 | |
509 | Acetylation | APETGELKSVARIVL CCCCCCCCEEEEEEE | 38.28 | - | |
520 | Acetylation | RIVLVPNKKVGLQFL EEEECCCCHHHHHHH | 42.64 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CP27A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CP27A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CP27A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRDX4_HUMAN | PRDX4 | physical | 21988832 | |
FAS_HUMAN | FASN | physical | 26344197 | |
QCR2_HUMAN | UQCRC2 | physical | 26344197 |
loading...