COX2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COX2_DROME
• UniProt AC: P00408
• Protein Name: Cytochrome c oxidase subunit 2
• Gene Name: mt:CoII
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 228
• Subcellular Localization: Mitochondrion inner membrane; Multi-pass membrane protein.
• Protein Description: Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1..
• Protein Sequence: MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNNYVNRFLLHGQLIEMIWTILPAIILLFIALPSLRLLYLLDEINEPSVTLKSIGHQWYWSYEYSDFNNIEFDSYMIPTNELMTDGFRLLDVDNRVVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLNQTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISSNNS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of COX2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COX2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COX2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COX2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ACADM_DROME	CG12262	physical	22036573
PRS4_DROME	Rpt2	physical	22036573
ATPG_DROME	ATPsyn-gamma	physical	22036573
ERD2_DROME	KdelR	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.