UniProt ID | CLD5_HUMAN | |
---|---|---|
UniProt AC | O00501 | |
Protein Name | Claudin-5 | |
Gene Name | CLDN5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 218 | |
Subcellular Localization |
Cell junction, tight junction. Cell membrane Multi-pass membrane protein. |
|
Protein Description | Plays a major role in tight junction-specific obliteration of the intercellular space.. | |
Protein Sequence | MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
86 | Phosphorylation | AARALTVSAVLLAFV HHHHHHHHHHHHHHH | 13.87 | - | |
148 | Phosphorylation | NIVVREFYDPSVPVS HHHHHHHCCCCCCCC | 23.38 | 22671590 | |
155 | Phosphorylation | YDPSVPVSQKYELGA CCCCCCCCCCCCCCC | 18.19 | 22461510 | |
207 | Phosphorylation | YSAPRRPTATGDYDK CCCCCCCCCCCCCCC | 34.73 | 21082442 | |
209 | Phosphorylation | APRRPTATGDYDKKN CCCCCCCCCCCCCCC | 32.82 | 23403867 | |
212 | Phosphorylation | RPTATGDYDKKNYV- CCCCCCCCCCCCCC- | 30.89 | 21253578 | |
217 | Phosphorylation | GDYDKKNYV------ CCCCCCCCC------ | 19.20 | 21253578 | |
233 | Phosphorylation | ---------------------- ---------------------- | - | ||
240 | Phosphorylation | ----------------------------- ----------------------------- | - | ||
292 | Phosphorylation | --------------------------------------------------------------------------------- --------------------------------------------------------------------------------- | - | ||
297 | Phosphorylation | -------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------- | 18083107 | ||
302 | Phosphorylation | ------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------- | 18083107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLD5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLD5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLD5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLD3_HUMAN | CLDN3 | physical | 12909588 | |
ZO1_HUMAN | TJP1 | physical | 10601346 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Global survey of phosphotyrosine signaling identifies oncogenickinases in lung cancer."; Rikova K., Guo A., Zeng Q., Possemato A., Yu J., Haack H., Nardone J.,Lee K., Reeves C., Li Y., Hu Y., Tan Z., Stokes M., Sullivan L.,Mitchell J., Wetzel R., Macneill J., Ren J.M., Yuan J.,Bakalarski C.E., Villen J., Kornhauser J.M., Smith B., Li D., Zhou X.,Gygi S.P., Gu T.-L., Polakiewicz R.D., Rush J., Comb M.J.; Cell 131:1190-1203(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-212 AND TYR-217, ANDMASS SPECTROMETRY. |