CLCA_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CLCA_RAT
• UniProt AC: P08081
• Protein Name: Clathrin light chain A
• Gene Name: Clta
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 248
• Subcellular Localization: Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Membrane, coated pit; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, spindle . Cytoplasmic face of coated pits and vesicles. In complex with TACC3 a
• Protein Description: Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge (By similarity)..
• Protein Sequence: MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQAHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAVKELEEWYARQDEQLQKTKASNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
105	Phosphorylation	SEVDRLQSEPESIRK HHHHHHHCCCHHHHH	60.76	22108457
109	Phosphorylation	RLQSEPESIRKWREE HHHCCCHHHHHHHHH	38.11	28551015
175 (in isoform 2)	Phosphorylation	-	32.71	28689409
176 (in isoform 2)	Phosphorylation	-	3.07	28689409
205	Phosphorylation	FVNDIDESSPGTEWE HHHCCCCCCCCCHHH	37.78	27097102
206	Phosphorylation	VNDIDESSPGTEWER HHCCCCCCCCCHHHH	25.87	27097102
209	Phosphorylation	IDESSPGTEWERVAR CCCCCCCCHHHHHHH	41.11	27097102
223	Acetylation	RLCDFNPKSSKQAKD HHHCCCCCCCHHHHH	69.35	-
236	Phosphorylation	KDVSRMRSVLISLKQ HHHHHHHHHHHHHHH	16.36	23984901
242	Acetylation	RSVLISLKQAPLVH- HHHHHHHHHCCCCC-	37.31	22902405
242	Ubiquitination	RSVLISLKQAPLVH- HHHHHHHHHCCCCC-	37.31	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CLCA_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CLCA_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CLCA_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TERA_RAT	Vcp	physical	8413590
CLCB_RAT	Cltb	physical	9188501

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.