| UniProt ID | CLCB_RAT | |
|---|---|---|
| UniProt AC | P08082 | |
| Protein Name | Clathrin light chain B | |
| Gene Name | Cltb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 229 | |
| Subcellular Localization |
Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. Membrane, coated pit Peripheral membrane protein Cytoplasmic side. Cytoplasmic face of coated pits and vesicles. |
|
| Protein Description | Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.. | |
| Protein Sequence | MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDSGFGAPAASQVASAQPGLASGGGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Phosphorylation | DFGFFSSSESGAPEA CCCCCCCCCCCCCHH | 34.28 | - | |
| 13 | Phosphorylation | GFFSSSESGAPEAAE CCCCCCCCCCCHHHH | 42.05 | - | |
| 133 | Acetylation | QEWREKAKKDLEEWN HHHHHHHHHHHHHHH | 58.87 | 22902405 | |
| 134 | Acetylation | EWREKAKKDLEEWNQ HHHHHHHHHHHHHHH | 72.85 | 22902405 | |
| 175 | Phosphorylation | DTIGYVASEEAFVKE CCHHEECCHHHHHHC | 26.40 | 30181290 | |
| 183 | Phosphorylation | EEAFVKESKEETPGT HHHHHHCCCCCCCCC | 39.38 | 30240740 | |
| 184 | Acetylation | EAFVKESKEETPGTE HHHHHCCCCCCCCCC | 61.74 | 22902405 | |
| 187 | Phosphorylation | VKESKEETPGTEWEK HHCCCCCCCCCCHHH | 28.27 | 28432305 | |
| 190 | Phosphorylation | SKEETPGTEWEKVAQ CCCCCCCCCHHHHHH | 38.84 | 28432305 | |
| 204 | Acetylation | QLCDFNPKSSKQCKD HHCCCCCCCCHHHCC | 69.35 | - | |
| 217 | Phosphorylation | KDVSRLRSVLMSLKQ CCHHHHHHHHHHHHC | 24.97 | 23984901 | |
| 223 | Acetylation | RSVLMSLKQTPLSR- HHHHHHHHCCCCCC- | 44.83 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLCB_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLCB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLCB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CLCB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
