UniProt ID | CLCB_RAT | |
---|---|---|
UniProt AC | P08082 | |
Protein Name | Clathrin light chain B | |
Gene Name | Cltb | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 229 | |
Subcellular Localization |
Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. Membrane, coated pit Peripheral membrane protein Cytoplasmic side. Cytoplasmic face of coated pits and vesicles. |
|
Protein Description | Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.. | |
Protein Sequence | MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDSGFGAPAASQVASAQPGLASGGGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | DFGFFSSSESGAPEA CCCCCCCCCCCCCHH | 34.28 | - | |
13 | Phosphorylation | GFFSSSESGAPEAAE CCCCCCCCCCCHHHH | 42.05 | - | |
133 | Acetylation | QEWREKAKKDLEEWN HHHHHHHHHHHHHHH | 58.87 | 22902405 | |
134 | Acetylation | EWREKAKKDLEEWNQ HHHHHHHHHHHHHHH | 72.85 | 22902405 | |
175 | Phosphorylation | DTIGYVASEEAFVKE CCHHEECCHHHHHHC | 26.40 | 30181290 | |
183 | Phosphorylation | EEAFVKESKEETPGT HHHHHHCCCCCCCCC | 39.38 | 30240740 | |
184 | Acetylation | EAFVKESKEETPGTE HHHHHCCCCCCCCCC | 61.74 | 22902405 | |
187 | Phosphorylation | VKESKEETPGTEWEK HHCCCCCCCCCCHHH | 28.27 | 28432305 | |
190 | Phosphorylation | SKEETPGTEWEKVAQ CCCCCCCCCHHHHHH | 38.84 | 28432305 | |
204 | Acetylation | QLCDFNPKSSKQCKD HHCCCCCCCCHHHCC | 69.35 | - | |
217 | Phosphorylation | KDVSRLRSVLMSLKQ CCHHHHHHHHHHHHC | 24.97 | 23984901 | |
223 | Acetylation | RSVLMSLKQTPLSR- HHHHHHHHCCCCCC- | 44.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLCB_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLCB_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLCB_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CLCB_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...