dbPTM

CLC2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CLC2_ARATH
UniProt AC	O04209
Protein Name	Clathrin light chain 2
Gene Name	CLC2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	258
Subcellular Localization	Cell membrane. Cytoplasmic vesicle membrane Peripheral membrane protein Cytoplasmic side. Membrane, coated pit Peripheral membrane protein Cytoplasmic side. Cytoplasm, cytoskeleton, phragmoplast. Cytoplasmic face of coated pits and vesicles (By s
Protein Description	Clathrin is the major protein of the polyhedral coat of coated pits and vesicles..
Protein Sequence	MSAFEDDSFVILNDDASESVPVSGSFDATDSFSAFDGSLQVEDSVDDVFAAPSSDYGAYSNGDGIFGSNGDHDGPILPPPSEMESDEGFALREWRRQNAIQLEEKEKREKELLKQIIEEADQYKEEFHKKIEVTCENNKAANREKEKLYLENQEKFYAESSKNYWKAIAELVPKEVPTIEKRRGKKEQQDPKKPTVSVIQGPKPGKPTDLTRMRQILVKLKHNPPSHLKLTSQPPSEEAAAPPKNVPETKPTEAVTAA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	SFSAFDGSLQVEDSV CCCCCCCCEEEECCC	19.92	28011693
195	Phosphorylation	QQDPKKPTVSVIQGP CCCCCCCCEEEEECC	34.00	23820729
197	Phosphorylation	DPKKPTVSVIQGPKP CCCCCCEEEEECCCC	18.91	23820729

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CLC2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CLC2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CLC2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CML18_ARATH	AT3G03000	physical	21798944
P2C12_ARATH	AT1G47380	physical	23924631
TPLAT_ARATH	TPLATE	physical	21187379
CLC2_ARATH	AT2G40060	physical	21187379
SNF12_ARATH	CHC1	physical	21187379
CLAH1_ARATH	AT3G11130	physical	26193449

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CLC2_ARATH

Related Literatures of Post-Translational Modification