dbPTM

CKS1_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CKS1_DROME
UniProt AC	Q24152
Protein Name	Cyclin-dependent kinases regulatory subunit
Gene Name	Cks30A
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	74
Subcellular Localization
Protein Description	Binds to the catalytic subunit of the cyclin dependent kinases Cdk1 and Cdk2, and is essential for their biological function..
Protein Sequence	MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPHILLFRRPKTD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CKS1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CKS1_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CKS1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CKS1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCNB3_DROME	CycB3	physical	22036573
CDK1_DROME	cdc2	physical	21827746
CDK1_DROME	cdc2	genetic	16033797
CCNA_DROME	CycA	genetic	16033797

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CKS1_DROME

Related Literatures of Post-Translational Modification