| UniProt ID | CKLF_HUMAN | |
|---|---|---|
| UniProt AC | Q9UBR5 | |
| Protein Name | Chemokine-like factor | |
| Gene Name | CKLF | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 152 | |
| Subcellular Localization |
Isoform 1: Secreted . Isoform 2: Membrane Multi-pass membrane protein . Isoform 4: Membrane Multi-pass membrane protein . |
|
| Protein Description | May play an important role in inflammation and regeneration of skeletal muscle. Partly inhibited by interleukin 10.; Isoform 1: has chemotactic response in monocytes, neutrophils and lymphocytes. [PubMed: 11415443 Binds CCR4] | |
| Protein Sequence | MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Ubiquitination | -MDNVQPKIKHRPFC -CCCCCCCCCCCCCE | 47.50 | - | |
| 9 | Ubiquitination | DNVQPKIKHRPFCFS CCCCCCCCCCCCEEE | 39.42 | - | |
| 14 | S-palmitoylation | KIKHRPFCFSVKGHV CCCCCCCEEEECHHH | 2.48 | 29575903 | |
| 18 | Methylation | RPFCFSVKGHVKMLR CCCEEEECHHHHHHH | 41.94 | 23644510 | |
| 22 | Methylation | FSVKGHVKMLRLALT EEECHHHHHHHHHHH | 26.92 | - | |
| 46 (in isoform 3) | Ubiquitination | - | 2.36 | 21890473 | |
| 78 (in isoform 2) | Ubiquitination | - | 4.97 | 21890473 | |
| 99 (in isoform 4) | Ubiquitination | - | 6.16 | 21890473 | |
| 131 | Ubiquitination | DGALIYRKLLFNPSG CCCHHHHHHHCCCCC | 32.35 | 21890473 | |
| 131 (in isoform 1) | Ubiquitination | - | 32.35 | 21890473 | |
| 137 | Phosphorylation | RKLLFNPSGPYQKKP HHHHCCCCCCCCCCC | 54.20 | 29978859 | |
| 140 | Phosphorylation | LFNPSGPYQKKPVHE HCCCCCCCCCCCCCC | 36.17 | 29978859 | |
| 142 | Ubiquitination | NPSGPYQKKPVHEKK CCCCCCCCCCCCCCC | 53.88 | - | |
| 143 | Ubiquitination | PSGPYQKKPVHEKKE CCCCCCCCCCCCCCC | 36.43 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CKLF_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CKLF_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CKLF_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HXB9_HUMAN | HOXB9 | physical | 28514442 | |
| APOB_HUMAN | APOB | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
