CK070_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CK070_HUMAN
• UniProt AC: Q9BRQ4
• Protein Name: Uncharacterized protein C11orf70
• Gene Name: C11orf70
• Organism: Homo sapiens (Human).
• Sequence Length: 267
• Protein Sequence: MATGELGDLGGYYFRFLPQKTFQSLSSKEITSRLRQWSMLGRIKAQAFGFDQTFQSYRKDDFVMAFFKDPNVIPNLKLLSDSSGQWIILGTEVKKIEAINVPCTQLSMSFFHRLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVISPYLETTKLIYKDLVSVRKNPQTKKIQITSSVFKVSAYDSAGMCYPSAKNHEQTFSYFIVDPIRRHLHVLYHCYGVGDMS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CK070_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CK070_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CK070_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CK070_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TCPW_HUMAN	CCT6B	physical	26186194
TPM2_HUMAN	TPM2	physical	26186194
TAB1_HUMAN	TAB1	physical	26186194
TPM2_HUMAN	TPM2	physical	28514442
TCPG_HUMAN	CCT3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.