CITE4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CITE4_HUMAN
• UniProt AC: Q96RK1
• Protein Name: Cbp/p300-interacting transactivator 4
• Gene Name: CITED4 {ECO:0000312|HGNC:HGNC:18696}
• Organism: Homo sapiens (Human).
• Sequence Length: 184
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Acts as transcriptional coactivator for TFAP2/AP-2. Enhances estrogen-dependent transactivation mediated by estrogen receptors. May function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP. May be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells..
• Protein Sequence: MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPGALAYGAFGPPSSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAAAPPPPAHALGGMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
183	Phosphorylation	APPAGSVSC------ CCCCCCCCC------	18.79	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CITE4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CITE4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CITE4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EP300_HUMAN	EP300	physical	11744733
AP2A_HUMAN	TFAP2A	physical	11744733
AP2B_HUMAN	TFAP2B	physical	11744733
AP2C_HUMAN	TFAP2C	physical	11744733

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.