CIDEC_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIDEC_HUMAN
• UniProt AC: Q96AQ7
• Protein Name: Cell death activator CIDE-3
• Gene Name: CIDEC
• Organism: Homo sapiens (Human).
• Sequence Length: 238
• Subcellular Localization: Nucleus. Endoplasmic reticulum. Lipid droplet. Diffuses quickly on lipid droplet surface, but becomes trapped and clustered at lipid droplet contact sites, thereby enabling its rapid enrichment at lipid droplet contact sites.
• Protein Description: Binds to lipid droplets and regulates their enlargement, thereby restricting lipolysis and favoring storage. At focal contact sites between lipid droplets, promotes directional net neutral lipid transfer from the smaller to larger lipid droplets. The transfer direction may be driven by the internal pressure difference between the contacting lipid droplet pair. Its role in neutral lipid transfer and lipid droplet enlargement is activated by the interaction with PLIN1. May act as a CEBPB coactivator in the white adipose tissue to control the expression of a subset of CEBPB downstream target genes, including SOCS1, SOCS3, TGFB1, TGFBR1, ID2 and XDH. When overexpressed in preadipocytes, induces apoptosis or increases cell susceptibility to apoptosis induced by serum deprivation or TGFB treatment. As mature adipocytes, that express high CIDEC levels, are quite resistant to apoptotic stimuli, the physiological significance of its role in apoptosis is unclear. May play a role in the modulation of the response to osmotic stress by preventing NFAT5 to translocate into the nucleus and activate its target genes expression..
• Protein Sequence: MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MEYAMKSLSL -----CCHHHHHHHH	15.65	24043423
7	Phosphorylation	-MEYAMKSLSLLYPK -CCHHHHHHHHHCCH	15.31	24043423
9	Phosphorylation	EYAMKSLSLLYPKSL CHHHHHHHHHCCHHH	24.34	24043423
12	Phosphorylation	MKSLSLLYPKSLSRH HHHHHHHCCHHHCCC	17.57	24043423
21	Phosphorylation	KSLSRHVSVRTSVVT HHHCCCCCCCHHHHH	10.35	24719451
34	Phosphorylation	VTQQLLSEPSPKAPR HHHHHHCCCCCCCCC	50.17	24719451
56	Acetylation	TADRSVRKGIMAYSL HCCHHHHHHHHHCCH	51.11	19817445

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIDEC_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIDEC_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIDEC_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIDEC_HUMAN	CIDEC	physical	19843876
EGR1_HUMAN	EGR1	physical	24742676
TRY2_HUMAN	PRSS2	physical	28514442
TOP1_HUMAN	TOP1	physical	28514442
AMFR_HUMAN	AMFR	physical	28656280

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.