CIB3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CIB3_HUMAN
• UniProt AC: Q96Q77
• Protein Name: Calcium and integrin-binding family member 3
• Gene Name: CIB3
• Organism: Homo sapiens (Human).
• Sequence Length: 187
• Protein Sequence: MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFLSTFHIRI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGNKQTVFTHEQL --CCCCCEECCHHHH	21.13	24043423
9	Phosphorylation	GNKQTVFTHEQLEAY CCCCEECCHHHHHHH	21.84	24043423
16	Phosphorylation	THEQLEAYQDCTFFT CHHHHHHHCCCCCCC	8.77	24043423
20	Phosphorylation	LEAYQDCTFFTRKEI HHHHCCCCCCCHHHH	30.03	24043423
23	Phosphorylation	YQDCTFFTRKEIMRL HCCCCCCCHHHHHHH	36.32	24043423
34	Phosphorylation	IMRLFYRYQDLAPQL HHHHHHHHHHHCCCC	8.59	24248375
48	Phosphorylation	LVPLDYTTCPDVKVP CCCCCCCCCCCCCCC	18.80	24248375
79	Phosphorylation	QRIAQVFSEDGDGHM HHHHHHHCCCCCCCE	35.60	22210691
96	Phosphorylation	DNFLDMFSVMSEMAP HHHHHHHHHHHHHCC	15.40	22210691
99	Phosphorylation	LDMFSVMSEMAPRDL HHHHHHHHHHCCCCH	23.28	22210691
165	Phosphorylation	GDHDGRLSLEDFQNM CCCCCCCCHHHHHHH	28.49	24719451
181	Phosphorylation	LRAPDFLSTFHIRI- HHCCCHHHEEEEEC-	29.08	30631047
182	Phosphorylation	RAPDFLSTFHIRI-- HCCCHHHEEEEEC--	22.75	30631047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CIB3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CIB3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CIB3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KLF17_HUMAN	KLF17	physical	25416956
KASH5_HUMAN	CCDC155	physical	25416956
BEND7_HUMAN	BEND7	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.