KLF17_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KLF17_HUMAN
• UniProt AC: Q5JT82
• Protein Name: Krueppel-like factor 17
• Gene Name: KLF17
• Organism: Homo sapiens (Human).
• Sequence Length: 389
• Subcellular Localization: Nucleus .
• Protein Description: Transcription repressor that binds to the promoter of target genes and prevents their expression. Acts as a negative regulator of epithelial-mesenchymal transition and metastasis in breast cancer. Specifically binds the 5'-CACCC-3' sequence in the promoter of ID1, a key metastasis regulator in breast cancer, and repress its expression. May be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development (By similarity)..
• Protein Sequence: MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPSIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPNGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
277	Phosphorylation	EGTGRRGSSEARPYC CCCCCCCCCCCCCCC	24.16	27251275
278	Phosphorylation	GTGRRGSSEARPYCC CCCCCCCCCCCCCCC	37.79	27251275
323	Phosphorylation	NWESCSWSFFRSDEL CCCCCCEEECCCHHH	9.75	24719451
340	Phosphorylation	HMRVHTRYRPYKCDQ HHCCCCCCCCCCCHH	19.66	29083192
343	Phosphorylation	VHTRYRPYKCDQCSR CCCCCCCCCCHHHCH	18.43	29083192
349	Phosphorylation	PYKCDQCSREFMRSD CCCCHHHCHHHHCHH	29.25	29083192
366	Methylation	KQHQKTHRPGPSDPQ HHHHHHCCCCCCCCC	43.00	115386875
383	Phosphorylation	NNNGEQDSPPAAGP- CCCCCCCCCCCCCC-	32.26	23663014

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KLF17_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KLF17_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KLF17_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of KLF17_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.