dbPTM

CH16_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CH16_DROME
UniProt AC	P22977
Protein Name	Chorion protein S16
Gene Name	Cp16
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	138
Subcellular Localization	Secreted .
Protein Description	Chorion membrane (egg shell) protein; plays a role in protecting the egg from the environment..
Protein Sequence	MSATLRLLCLMACCVALAVANRPNYGGSGYGASYGDVVKAAETAEAQASALTNAAGAAASAAKLDGADWNSLNRYGWEQGRPLLAKPYGPLDPLYAAALPPRSFVAEVDPVFKKSQYGGSYGENAYLKTDAKLGVVAI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CH16_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CH16_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CH16_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CH16_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
TTKB_DROME	ttk	genetic	23545328
TTKA_DROME	ttk	genetic	23545328

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CH16_DROME

Related Literatures of Post-Translational Modification