dbPTM

CG1C_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CG1C_SCHPO
UniProt AC	O74627
Protein Name	Cyclin pch1
Gene Name	pch1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	342
Subcellular Localization	Nucleus.
Protein Description	Essential for progression through the whole cell cycle..
Protein Sequence	MSEVIKSVPPGSQNTSQWIISKDQLVFTPSALDGIPLDQEEIQRSKGCNFIINVGLRLKLPQTALATANIYFHRFYLRFSLKNYHYYEVAATCIFLATKVEDSVRKLRDIVINCAKVAQKNSNVLVDEQTKEYWRWRDVILYTEEVLLEALCFDFTVEHPYPYVLSFIKKFVADDKNVTKVAWTYINDSTRSIACLLYSPKTIAAAAFQFALEKNEINLSTTTDGLPVWMEESQVSYEDVKGVLTLIDSLYKKINPSKQALPIDQKNGSHASSVAPGTPSSLASVSTQATPQHQNSSGRTDSFHSLNTETPSKSTVDDQILSTAAQPKKSSDTDKEMETEAS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
300	Phosphorylation	HQNSSGRTDSFHSLN CCCCCCCCCCCCCCC	39.25	28889911
302	Phosphorylation	NSSGRTDSFHSLNTE CCCCCCCCCCCCCCC	25.01	28889911
305	Phosphorylation	GRTDSFHSLNTETPS CCCCCCCCCCCCCCC	22.70	29996109
308	Phosphorylation	DSFHSLNTETPSKST CCCCCCCCCCCCCCC	46.67	29996109
310	Phosphorylation	FHSLNTETPSKSTVD CCCCCCCCCCCCCCC	30.72	29996109
312	Phosphorylation	SLNTETPSKSTVDDQ CCCCCCCCCCCCCHH	46.81	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CG1C_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CG1C_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CG1C_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDK1_SCHPO	cdc2	physical	9115279
SPT5_SCHPO	spt5	physical	22508988
SPB1_SCHPO	spb1	physical	22508988

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CG1C_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-300 AND SER-302, ANDMASS SPECTROMETRY.	18257517 [Abstract]