| UniProt ID | CFI3_ARATH | |
|---|---|---|
| UniProt AC | Q8VZW3 | |
| Protein Name | Probable chalcone--flavonone isomerase 3 | |
| Gene Name | CHI3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 209 | |
| Subcellular Localization | ||
| Protein Description | Involved in anthocyanin biosynthesis.. | |
| Protein Sequence | MGTEMVMVHEVPFPPQIITSKPLSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDDFFDALASAEMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKYEEEEETELEKVVGFFQSKYFKANSVITYHFSAKDGICEIGFETEGKEEEKLKVENANVVGMMQRWYLSGSRGVSPSTIVSIADSISAVLT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 193 | Phosphorylation | LSGSRGVSPSTIVSI HCCCCCCCHHHHHHH | 24894044 | ||
| 195 | Phosphorylation | GSRGVSPSTIVSIAD CCCCCCHHHHHHHHH | 24894044 | ||
| 196 | Phosphorylation | SRGVSPSTIVSIADS CCCCCHHHHHHHHHH | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CFI3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CFI3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CFI3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SUMO3_ARATH | SUMO3 | physical | 20855607 | |
| SUMO1_ARATH | SUMO1 | physical | 20855607 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...