CED9_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CED9_CAEEL
• UniProt AC: P41958
• Protein Name: Apoptosis regulator ced-9
• Gene Name: ced-9
• Organism: Caenorhabditis elegans.
• Sequence Length: 280
• Subcellular Localization: Perikaryon . Cell junction, synapse . Endomembrane system ; Peripheral membrane protein. Mitochondrion membrane ; Peripheral membrane protein . Intracellular membranes, mitochondrial, and perinuclear region (PubMed:9027313, PubMed:10688797). Localize
• Protein Description: Plays a major role in programmed cell death (PCD, apoptosis). [PubMed: 7907274]
• Protein Sequence: MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Phosphorylation	SDAQDLPSPSRQAST CCCCCCCCCCCCCCC	42.69	30078680
61	Phosphorylation	QASTRRMSIGESIDG CCCCCCCCCCCCCCC	26.15	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CED9_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CED9_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CED9_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DRE1_CAEEL	dre-1	physical	23431138
CED4_CAEEL	ced-4	physical	9027312
B2CL1_HUMAN	BCL2L1	physical	9027312

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.