dbPTM

CCR2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CCR2_MOUSE
UniProt AC	P51683
Protein Name	C-C chemokine receptor type 2
Gene Name	Ccr2
Organism	Mus musculus (Mouse).
Sequence Length	373
Subcellular Localization	Cell membrane Multi-pass membrane protein . The chemoattractant receptors are reportedly distributed throughout the cell surface after stimulation with a ligand, such as CCL2, they are rapidly recruited into microdomain clusters at the cell membra
Protein Description	Receptor for the CCL2, CCL7 and CCL12 chemokines. [PubMed: 8996246 Receptor for the beta-defensin DEFB106A/DEFB106B (By similarity Transduces a signal by increasing intracellular calcium ion levels]
Protein Sequence	MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
152	Phosphorylation	ILLTIDRYLAIVHAV HHHHHHHHHHHHHHH	9.20	-
370	Phosphorylation	STGEQEVSVGL---- CCCCEEECCCC----	15.09	27180971

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
152	Y	Phosphorylation	Kinase	JAK2	Q62120	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CCR2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CCR2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CCL2_MOUSE	Ccl2	physical	8662823
CCL7_MOUSE	Ccl7	physical	8662823

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CCR2_MOUSE

Related Literatures of Post-Translational Modification