CCL2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCL2_MOUSE
• UniProt AC: P10148
• Protein Name: C-C motif chemokine 2
• Gene Name: Ccl2
• Organism: Mus musculus (Mouse).
• Sequence Length: 148
• Subcellular Localization: Secreted.
• Protein Description: Chemotactic factor that attracts monocytes, but not neutrophils..
• Protein Sequence: MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Pyrrolidone_carboxylic_acid	WSIHVLAQPDAVNAP HHEEECCCCCCCCCC	32.04	-
24	Pyrrolidone_carboxylic_acid	WSIHVLAQPDAVNAP HHEEECCCCCCCCCC	32.04	-
51	Phosphorylation	PMSRLESYKRITSSR CHHHHHHHCHHCCCC	8.56	20139300
126	N-linked_Glycosylation	LTRKSEANASTTFST EEECCCCCCCCEEEE	30.30	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCL2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCL2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCL2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CCR2_MOUSE	Ccr2	physical	8631787

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.