UniProt ID | CCL2_MOUSE | |
---|---|---|
UniProt AC | P10148 | |
Protein Name | C-C motif chemokine 2 | |
Gene Name | Ccl2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 148 | |
Subcellular Localization | Secreted. | |
Protein Description | Chemotactic factor that attracts monocytes, but not neutrophils.. | |
Protein Sequence | MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Pyrrolidone_carboxylic_acid | WSIHVLAQPDAVNAP HHEEECCCCCCCCCC | 32.04 | - | |
24 | Pyrrolidone_carboxylic_acid | WSIHVLAQPDAVNAP HHEEECCCCCCCCCC | 32.04 | - | |
51 | Phosphorylation | PMSRLESYKRITSSR CHHHHHHHCHHCCCC | 8.56 | 20139300 | |
126 | N-linked_Glycosylation | LTRKSEANASTTFST EEECCCCCCCCEEEE | 30.30 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCL2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCL2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCL2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CCR2_MOUSE | Ccr2 | physical | 8631787 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...