CCL7_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCL7_MOUSE
• UniProt AC: Q03366
• Protein Name: C-C motif chemokine 7
• Gene Name: Ccl7
• Organism: Mus musculus (Mouse).
• Sequence Length: 97
• Subcellular Localization: Secreted.
• Protein Description: Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity (By similarity)..
• Protein Sequence: MRISATLLCLLLIAAAFSIQVWAQPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
24	Pyrrolidone_carboxylic_acid	FSIQVWAQPDGPNAS HHCHHHCCCCCCCCC	22.39	-
24	Pyrrolidone_carboxylic_acid	FSIQVWAQPDGPNAS HHCHHHCCCCCCCCC	22.39	-
29	N-linked_Glycosylation	WAQPDGPNASTCCYV HCCCCCCCCCCCEEE	52.64	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCL7_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCL7_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCL7_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CCL7_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.