UniProt ID | CCNA2_MOUSE | |
---|---|---|
UniProt AC | P51943 | |
Protein Name | Cyclin-A2 {ECO:0000303|PubMed:8575639} | |
Gene Name | Ccna2 {ECO:0000312|MGI:MGI:108069} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 422 | |
Subcellular Localization | Nucleus . Cytoplasm . Exclusively nuclear during interphase. Detected in the nucleus and the cytoplasm at prophase. Cytoplasmic when associated with SCAPER. | |
Protein Description | Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.. | |
Protein Sequence | MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MPGTSRHS -------CCCCCCCC | 6.61 | - | |
5 | Phosphorylation | ---MPGTSRHSGRDA ---CCCCCCCCCCHH | 33.63 | - | |
14 | Phosphorylation | HSGRDAGSALLSLHQ CCCCHHHHHHHHHCH | 19.91 | 22817900 | |
45 | Ubiquitination | PRAQAVLKAGNVRGP HHHHHHHHHCCCCCC | 47.88 | - | |
67 | Acetylation | TRRVAPLKDLPINDE CCCCCCCCCCCCCCC | 57.04 | 23806337 | |
421 | Phosphorylation | LNPPETLSV------ CCCCCCCCC------ | 32.95 | 19233286 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCNA2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCNA2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCNA2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDK2_MOUSE | Cdk2 | physical | 10068472 | |
CDN1B_MOUSE | Cdkn1b | physical | 8547220 | |
CDK2_MOUSE | Cdk2 | physical | 8547220 | |
CDK1_MOUSE | Cdk1 | physical | 8226784 | |
CDK2_MOUSE | Cdk2 | physical | 8226784 | |
E2F3_MOUSE | E2f3 | physical | 11980909 | |
CDK2_MOUSE | Cdk2 | physical | 22898779 | |
CDK2_HUMAN | CDK2 | physical | 18667424 | |
CDK2_MOUSE | Cdk2 | physical | 18635963 | |
CDK2_MOUSE | Cdk2 | physical | 16627785 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...