UniProt ID | CASP9_MOUSE | |
---|---|---|
UniProt AC | Q8C3Q9 | |
Protein Name | Caspase-9 | |
Gene Name | Casp9 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 454 | |
Subcellular Localization | ||
Protein Description | Involved in the activation cascade of caspases responsible for apoptosis execution. Binding of caspase-9 to Apaf-1 leads to activation of the protease which then cleaves and activates caspase-3. Promotes DNA damage-induced apoptosis in a ABL1/c-Abl-dependent manner. Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) (By similarity).. | |
Protein Sequence | MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSRRDQARQLVTDLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLTAKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVPGKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
132 | Phosphorylation | RVVKLDPSQPAVGNL EEEECCCCCCCCCCC | 22324799 | ||
140 | Phosphorylation | QPAVGNLTPVVLGPE CCCCCCCCCEECCHH | 24719451 | ||
163 | Phosphorylation | PEVLRPETPRPVDIG HHHCCCCCCCCCCCC | 25367039 | ||
171 | Phosphorylation | PRPVDIGSGGAHDVC CCCCCCCCCCCCCEE | 25367039 | ||
191 | Phosphorylation | RGHADMAYTLDSDPC CCCCCEEEECCCCCC | 15657060 | ||
339 | Phosphorylation | HGFEVACTSSQGRTL CCEEEEEECCCCCCC | 30635358 | ||
340 | Phosphorylation | GFEVACTSSQGRTLD CEEEEEECCCCCCCC | 30635358 | ||
341 | Phosphorylation | FEVACTSSQGRTLDS EEEEEECCCCCCCCC | 30635358 | ||
345 | Phosphorylation | CTSSQGRTLDSDSEP EECCCCCCCCCCCCC | 17203969 | ||
348 | Phosphorylation | SQGRTLDSDSEPDAV CCCCCCCCCCCCCCC | 17203969 | ||
350 | Phosphorylation | GRTLDSDSEPDAVPY CCCCCCCCCCCCCCC | 17203969 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
163 | T | Phosphorylation | Kinase | DYRK1A | Q13627 | PSP |
163 | T | Phosphorylation | Kinase | DYRK1A | Q61214 | PSP |
163 | T | Phosphorylation | Kinase | MAPK1 | P63085 | Uniprot |
191 | Y | Phosphorylation | Kinase | ABL1 | P00520 | Uniprot |
348 | S | Phosphorylation | Kinase | CSNK2A1 | Q60737 | GPS |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CASP9_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TERA_MOUSE | Vcp | physical | 14561754 | |
PDCD6_MOUSE | Pdcd6 | physical | 14561754 | |
JUN_MOUSE | Jun | physical | 23678002 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...