| UniProt ID | CASP9_MOUSE | |
|---|---|---|
| UniProt AC | Q8C3Q9 | |
| Protein Name | Caspase-9 | |
| Gene Name | Casp9 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 454 | |
| Subcellular Localization | ||
| Protein Description | Involved in the activation cascade of caspases responsible for apoptosis execution. Binding of caspase-9 to Apaf-1 leads to activation of the protease which then cleaves and activates caspase-3. Promotes DNA damage-induced apoptosis in a ABL1/c-Abl-dependent manner. Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) (By similarity).. | |
| Protein Sequence | MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGSRRDQARQLVTDLETRGRQALPLFISCLEDTGQGTLASLLQSGRQAAKQDPEAVKPLDHLVPVVLGPMGLTAKEQRVVKLDPSQPAVGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVPGKIRGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQSLLLRVANAVSAKGTYKQIPGCFNFLRKKLFFKTS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 132 | Phosphorylation | RVVKLDPSQPAVGNL EEEECCCCCCCCCCC | 22324799 | ||
| 140 | Phosphorylation | QPAVGNLTPVVLGPE CCCCCCCCCEECCHH | 24719451 | ||
| 163 | Phosphorylation | PEVLRPETPRPVDIG HHHCCCCCCCCCCCC | 25367039 | ||
| 171 | Phosphorylation | PRPVDIGSGGAHDVC CCCCCCCCCCCCCEE | 25367039 | ||
| 191 | Phosphorylation | RGHADMAYTLDSDPC CCCCCEEEECCCCCC | 15657060 | ||
| 339 | Phosphorylation | HGFEVACTSSQGRTL CCEEEEEECCCCCCC | 30635358 | ||
| 340 | Phosphorylation | GFEVACTSSQGRTLD CEEEEEECCCCCCCC | 30635358 | ||
| 341 | Phosphorylation | FEVACTSSQGRTLDS EEEEEECCCCCCCCC | 30635358 | ||
| 345 | Phosphorylation | CTSSQGRTLDSDSEP EECCCCCCCCCCCCC | 17203969 | ||
| 348 | Phosphorylation | SQGRTLDSDSEPDAV CCCCCCCCCCCCCCC | 17203969 | ||
| 350 | Phosphorylation | GRTLDSDSEPDAVPY CCCCCCCCCCCCCCC | 17203969 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 163 | T | Phosphorylation | Kinase | DYRK1A | Q13627 | PSP |
| 163 | T | Phosphorylation | Kinase | DYRK1A | Q61214 | PSP |
| 163 | T | Phosphorylation | Kinase | MAPK1 | P63085 | Uniprot |
| 191 | Y | Phosphorylation | Kinase | ABL1 | P00520 | Uniprot |
| 348 | S | Phosphorylation | Kinase | CSNK2A1 | Q60737 | GPS |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CASP9_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TERA_MOUSE | Vcp | physical | 14561754 | |
| PDCD6_MOUSE | Pdcd6 | physical | 14561754 | |
| JUN_MOUSE | Jun | physical | 23678002 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...