UniProt ID | PDCD6_MOUSE | |
---|---|---|
UniProt AC | P12815 | |
Protein Name | Programmed cell death protein 6 | |
Gene Name | Pdcd6 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 191 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein . Cytoplasmic vesicle, COPII-coated vesicle membrane . Cytoplasm . Nucleus . Endosome . Interaction with RBM22 induces relocalization from the cytoplasm to the nucleus. Translocated from th |
|
Protein Description | Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. [PubMed: 10744743] | |
Protein Sequence | MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAYSYRPG ------CCCCCCCCC | 18.33 | - | |
4 | Phosphorylation | ----MAAYSYRPGPG ----CCCCCCCCCCC | 9.19 | 29514104 | |
107 | Phosphorylation | RTYDRDNSGMIDKNE HHCCCCCCCCCCHHH | 33.74 | 25195567 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDCD6_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDCD6_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDCD6_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CPNE4_HUMAN | CPNE4 | physical | 12522145 | |
CPNE1_HUMAN | CPNE1 | physical | 12522145 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...