dbPTM

PDCD6_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PDCD6_MOUSE
UniProt AC	P12815
Protein Name	Programmed cell death protein 6
Gene Name	Pdcd6
Organism	Mus musculus (Mouse).
Sequence Length	191
Subcellular Localization	Endoplasmic reticulum membrane Peripheral membrane protein . Cytoplasmic vesicle, COPII-coated vesicle membrane . Cytoplasm . Nucleus . Endosome . Interaction with RBM22 induces relocalization from the cytoplasm to the nucleus. Translocated from th
Protein Description	Calcium sensor that plays a key role in processes such as endoplasmic reticulum (ER)-Golgi vesicular transport, endosomal biogenesis or membrane repair. [PubMed: 10744743]
Protein Sequence	MAAYSYRPGPGGGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAYSYRPG ------CCCCCCCCC	18.33	-
4	Phosphorylation	----MAAYSYRPGPG ----CCCCCCCCCCC	9.19	29514104
107	Phosphorylation	RTYDRDNSGMIDKNE HHCCCCCCCCCCHHH	33.74	25195567

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PDCD6_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PDCD6_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PDCD6_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CPNE4_HUMAN	CPNE4	physical	12522145
CPNE1_HUMAN	CPNE1	physical	12522145

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PDCD6_MOUSE

Related Literatures of Post-Translational Modification