dbPTM

CASB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CASB_HUMAN
UniProt AC	P05814
Protein Name	Beta-casein
Gene Name	CSN2
Organism	Homo sapiens (Human).
Sequence Length	226
Subcellular Localization	Secreted.
Protein Description	Important role in determination of the surface properties of the casein micelles..
Protein Sequence	MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	ALALARETIESLSSS HHHHHHHHHHHHCCC	25.21	20068231
21	Phosphorylation	LARETIESLSSSEES HHHHHHHHHCCCCHH	29.69	20068231
23	Phosphorylation	RETIESLSSSEESIT HHHHHHHCCCCHHHH	40.89	20068231
24	Phosphorylation	ETIESLSSSEESITE HHHHHHCCCCHHHHH	47.24	20068231
25	Phosphorylation	TIESLSSSEESITEY HHHHHCCCCHHHHHH	41.84	20068231
28	Phosphorylation	SLSSSEESITEYKQK HHCCCCHHHHHHHHH	30.66	20068231
30	Phosphorylation	SSSEESITEYKQKVE CCCCHHHHHHHHHHH	42.41	20068231
32	Phosphorylation	SEESITEYKQKVEKV CCHHHHHHHHHHHHH	15.29	20068231
120	Phosphorylation	RVMPVLKSPTIPFFD CEEEEECCCCCCCCC	24.10	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CASB_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
24	S	Phosphorylation	6715339
Form 1-P is phosphorylated once; half of the molecules are phosphorylated on Ser-24, half on Ser-25.
25	S	Phosphorylation	6715339
Form 1-P is phosphorylated once; half of the molecules are phosphorylated on Ser-24, half on Ser-25.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CASB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FHL2_HUMAN	FHL2	physical	25416956
COR2A_HUMAN	CORO2A	physical	28514442
PP2BC_HUMAN	PPP3CC	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CASB_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Analysis of the human casein phosphoproteome by 2-D electrophoresisand MALDI-TOF/TOF MS reveals new phosphoforms."; Poth A.G., Deeth H.C., Alewood P.F., Holland J.W.; J. Proteome Res. 7:5017-5027(2008). Cited for: PROTEIN SEQUENCE OF 18-33, PHOSPHORYLATION AT THR-18; SER-21; SER-23;SER-24 AND SER-25, AND MASS SPECTROMETRY.	18847231 [Abstract]
"Human beta-casein. Amino acid sequence and identification ofphosphorylation sites."; Greenberg R., Groves M.L., Dower H.J.; J. Biol. Chem. 259:5132-5138(1984). Cited for: PROTEIN SEQUENCE OF 16-226, AND PHOSPHORYLATION AT THR-18; SER-21;SER-23; SER-24 AND SER-25.	6715339 [Abstract]