UniProt ID | CASB_HUMAN | |
---|---|---|
UniProt AC | P05814 | |
Protein Name | Beta-casein | |
Gene Name | CSN2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 226 | |
Subcellular Localization | Secreted. | |
Protein Description | Important role in determination of the surface properties of the casein micelles.. | |
Protein Sequence | MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
18 | Phosphorylation | ALALARETIESLSSS HHHHHHHHHHHHCCC | 25.21 | 20068231 | |
21 | Phosphorylation | LARETIESLSSSEES HHHHHHHHHCCCCHH | 29.69 | 20068231 | |
23 | Phosphorylation | RETIESLSSSEESIT HHHHHHHCCCCHHHH | 40.89 | 20068231 | |
24 | Phosphorylation | ETIESLSSSEESITE HHHHHHCCCCHHHHH | 47.24 | 20068231 | |
25 | Phosphorylation | TIESLSSSEESITEY HHHHHCCCCHHHHHH | 41.84 | 20068231 | |
28 | Phosphorylation | SLSSSEESITEYKQK HHCCCCHHHHHHHHH | 30.66 | 20068231 | |
30 | Phosphorylation | SSSEESITEYKQKVE CCCCHHHHHHHHHHH | 42.41 | 20068231 | |
32 | Phosphorylation | SEESITEYKQKVEKV CCHHHHHHHHHHHHH | 15.29 | 20068231 | |
120 | Phosphorylation | RVMPVLKSPTIPFFD CEEEEECCCCCCCCC | 24.10 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CASB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CASB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FHL2_HUMAN | FHL2 | physical | 25416956 | |
COR2A_HUMAN | CORO2A | physical | 28514442 | |
PP2BC_HUMAN | PPP3CC | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Analysis of the human casein phosphoproteome by 2-D electrophoresisand MALDI-TOF/TOF MS reveals new phosphoforms."; Poth A.G., Deeth H.C., Alewood P.F., Holland J.W.; J. Proteome Res. 7:5017-5027(2008). Cited for: PROTEIN SEQUENCE OF 18-33, PHOSPHORYLATION AT THR-18; SER-21; SER-23;SER-24 AND SER-25, AND MASS SPECTROMETRY. | |
"Human beta-casein. Amino acid sequence and identification ofphosphorylation sites."; Greenberg R., Groves M.L., Dower H.J.; J. Biol. Chem. 259:5132-5138(1984). Cited for: PROTEIN SEQUENCE OF 16-226, AND PHOSPHORYLATION AT THR-18; SER-21;SER-23; SER-24 AND SER-25. |