dbPTM

CAH5A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CAH5A_HUMAN
UniProt AC	P35218
Protein Name	Carbonic anhydrase 5A, mitochondrial
Gene Name	CA5A
Organism	Homo sapiens (Human).
Sequence Length	305
Subcellular Localization	Mitochondrion.
Protein Description	Reversible hydration of carbon dioxide. Low activity..
Protein Sequence	MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Phosphorylation	MRPGRWCSQRSCAWQ CCCCCCCCCCCEEEE	22.97	-
260	Phosphorylation	EVAPSQLSAFRTLLF CCCHHHHHHHHHHHH	20.09	24719451
264	Phosphorylation	SQLSAFRTLLFSALG HHHHHHHHHHHHHHC	22.74	27732954
268	Phosphorylation	AFRTLLFSALGEEEK HHHHHHHHHHCHHHH	23.66	27732954
291	Ubiquitination	LQPLMNRKVWASFQA CHHHCCCHHHHEEEE	36.80	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CAH5A_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CAH5A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CAH5A_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LMNA_HUMAN	LMNA	physical	26490262
TBB3_HUMAN	TUBB3	physical	26490262
MPPA_HUMAN	PMPCA	physical	28514442
SIR3_HUMAN	SIRT3	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
615751	Hyperammonemia due to carbonic anhydrase VA deficiency (CA5AD)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB01194	Brinzolamide
DB00909	Zonisamide

Regulatory Network of CAH5A_HUMAN

Related Literatures of Post-Translational Modification