UniProt ID | C42S1_HUMAN | |
---|---|---|
UniProt AC | Q9NRR8 | |
Protein Name | CDC42 small effector protein 1 | |
Gene Name | CDC42SE1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 79 | |
Subcellular Localization |
Cytoplasm, cytoskeleton. Cell membrane Lipid-anchor. Recruited to the activated TCR prior actin polymerization. |
|
Protein Description | Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.. | |
Protein Sequence | MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | S-palmitoylation | EFWHKLGCCVVEKPQ HHHHHHCCEEECCCC | 2.00 | 29575903 | |
11 | S-palmitoylation | FWHKLGCCVVEKPQP HHHHHCCEEECCCCC | 3.49 | 29575903 | |
15 | Ubiquitination | LGCCVVEKPQPKKKR HCCEEECCCCCCCCC | 37.03 | 23000965 | |
19 | Ubiquitination | VVEKPQPKKKRRRID EECCCCCCCCCCCCC | 66.72 | 23000965 | |
20 | Ubiquitination | VEKPQPKKKRRRIDR ECCCCCCCCCCCCCH | 59.19 | 23000965 | |
21 | Ubiquitination | EKPQPKKKRRRIDRT CCCCCCCCCCCCCHH | 58.21 | 23000965 | |
44 | Phosphorylation | VHLTHIGSGEMGAGD EEEEEECCCCCCCCC | 30.86 | 27251275 | |
56 | Phosphorylation | AGDGLAMTGAVQEQM CCCCCHHHHHHHHHH | 19.17 | 22210691 | |
65 | Phosphorylation | AVQEQMRSKGNRDRP HHHHHHHHCCCCCCC | 39.30 | 22210691 | |
74 | Phosphorylation | GNRDRPWSNSRGL-- CCCCCCCCCCCCC-- | 27.84 | 22167270 | |
76 | Phosphorylation | RDRPWSNSRGL---- CCCCCCCCCCC---- | 23.39 | 22167270 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of C42S1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of C42S1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of C42S1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MIPEP_HUMAN | MIPEP | physical | 28514442 | |
IF2P_HUMAN | EIF5B | physical | 28514442 | |
CDC42_HUMAN | CDC42 | physical | 28514442 | |
BTBD1_HUMAN | BTBD1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...