C42S1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: C42S1_HUMAN
• UniProt AC: Q9NRR8
• Protein Name: CDC42 small effector protein 1
• Gene Name: CDC42SE1
• Organism: Homo sapiens (Human).
• Sequence Length: 79
• Subcellular Localization: Cytoplasm, cytoskeleton. Cell membrane; Lipid-anchor. Recruited to the activated TCR prior actin polymerization.
• Protein Description: Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages..
• Protein Sequence: MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	S-palmitoylation	EFWHKLGCCVVEKPQ HHHHHHCCEEECCCC	2.00	29575903
11	S-palmitoylation	FWHKLGCCVVEKPQP HHHHHCCEEECCCCC	3.49	29575903
15	Ubiquitination	LGCCVVEKPQPKKKR HCCEEECCCCCCCCC	37.03	23000965
19	Ubiquitination	VVEKPQPKKKRRRID EECCCCCCCCCCCCC	66.72	23000965
20	Ubiquitination	VEKPQPKKKRRRIDR ECCCCCCCCCCCCCH	59.19	23000965
21	Ubiquitination	EKPQPKKKRRRIDRT CCCCCCCCCCCCCHH	58.21	23000965
44	Phosphorylation	VHLTHIGSGEMGAGD EEEEEECCCCCCCCC	30.86	27251275
56	Phosphorylation	AGDGLAMTGAVQEQM CCCCCHHHHHHHHHH	19.17	22210691
65	Phosphorylation	AVQEQMRSKGNRDRP HHHHHHHHCCCCCCC	39.30	22210691
74	Phosphorylation	GNRDRPWSNSRGL-- CCCCCCCCCCCCC--	27.84	22167270
76	Phosphorylation	RDRPWSNSRGL---- CCCCCCCCCCC----	23.39	22167270

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of C42S1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of C42S1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of C42S1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MIPEP_HUMAN	MIPEP	physical	28514442
IF2P_HUMAN	EIF5B	physical	28514442
CDC42_HUMAN	CDC42	physical	28514442
BTBD1_HUMAN	BTBD1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.