BZP10_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BZP10_ARATH
• UniProt AC: O22763
• Protein Name: Basic leucine zipper 10
• Gene Name: BZIP10
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 411
• Subcellular Localization: Nucleus . Cytoplasm . Shuttles between the nucleus and the cytoplasm. Retained outside the nucleus by LSD1 to prevent cell death.
• Protein Description: Transcription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters. Binds to the 5'-ACGT-3' motif of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. Involved in the defense responses to the biotrophic pathogen Hyaloperonospora parasitica and oxidative stress responses; mediates positively cell death. [PubMed: 12657652]
• Protein Sequence: MNSIFSIDDFSDPFWETPPIPLNPDSSKPVTADEVSQSQPEWTFEMFLEEISSSAVSSEPLGNNNNAIVGVSSAQSLPSVSGQNDFEDDSRFRDRDSGNLDCAAPMTTKTVIVDSDDYRRVLKNKLETECATVVSLRVGSVKPEDSTSSPETQLQPVQSSPLTQGELGVTSSLPAEVKKTGVSMKQVTSGSSREYSDDEDLDEENETTGSLKPEDVKKSRRMLSNRESARRSRRRKQEQTSDLETQVNDLKGEHSSLLKQLSNMNHKYDEAAVGNRILKADIETLRAKVKMAEETVKRVTGMNPMLLGRSSGHNNNNRMPITGNNRMDSSSIIPAYQPHSNLNHMSNQNIGIPTILPPRLGNNFAAPPSQTSSPLQRIRNGQNHHVTPSANPYGWNTEPQNDSAWPKKCVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
115	Phosphorylation	TKTVIVDSDDYRRVL EEEEEECCHHHHHHH	22.84	17317660
195	Phosphorylation	TSGSSREYSDDEDLD CCCCCCCCCCCCCCC	19.11	23776212
196	Phosphorylation	SGSSREYSDDEDLDE CCCCCCCCCCCCCCC	33.56	30291188
207	Phosphorylation	DLDEENETTGSLKPE CCCCCCCCCCCCCHH	48.30	23776212
208	Phosphorylation	LDEENETTGSLKPED CCCCCCCCCCCCHHH	20.70	23776212
210	Phosphorylation	EENETTGSLKPEDVK CCCCCCCCCCHHHHH	31.00	23776212
224	Phosphorylation	KKSRRMLSNRESARR HHHHHHHHHHHHHHH	25.21	19880383
284	Phosphorylation	ILKADIETLRAKVKM HHHHHHHHHHHHHHH	23.13	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BZP10_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BZP10_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BZP10_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABI3_ARATH	ABI3	physical	12657652
LSD1_ARATH	AT4G20380	physical	16957775
BZIP1_ARATH	bZIP1	physical	16709202
BZP25_ARATH	BZIP25	physical	16709202
BZP63_ARATH	BZO2H3	physical	16709202
BZIP9_ARATH	BZIP9	physical	16709202

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.