UniProt ID | BZIP1_ARATH | |
---|---|---|
UniProt AC | Q9FGX2 | |
Protein Name | Basic leucine zipper 1 | |
Gene Name | BZIP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 145 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters involved in sugar signaling. Activated by low energy stress both at transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response. [PubMed: 20080816] | |
Protein Sequence | MANAEKTSSGSDIDEKKRKRKLSNRESARRSRLKKQKLMEDTIHEISSLERRIKENSERCRAVKQRLDSVETENAGLRSEKIWLSSYVSDLENMIATTSLTLTQSGGGDCVDDQNANAGIAVGDCRRTPWKLSCGSLQPMASFKT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | AEKTSSGSDIDEKKR CCCCCCCCCCCHHHH | 33.08 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BZIP1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BZIP1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BZIP1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BZP25_ARATH | BZIP25 | physical | 16709202 | |
BZP63_ARATH | BZO2H3 | physical | 16709202 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...