BZIP1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BZIP1_ARATH
• UniProt AC: Q9FGX2
• Protein Name: Basic leucine zipper 1
• Gene Name: BZIP1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 145
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters involved in sugar signaling. Activated by low energy stress both at transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response. [PubMed: 20080816]
• Protein Sequence: MANAEKTSSGSDIDEKKRKRKLSNRESARRSRLKKQKLMEDTIHEISSLERRIKENSERCRAVKQRLDSVETENAGLRSEKIWLSSYVSDLENMIATTSLTLTQSGGGDCVDDQNANAGIAVGDCRRTPWKLSCGSLQPMASFKT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	AEKTSSGSDIDEKKR CCCCCCCCCCCHHHH	33.08	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BZIP1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BZIP1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BZIP1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BZP25_ARATH	BZIP25	physical	16709202
BZP63_ARATH	BZO2H3	physical	16709202

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.