| UniProt ID | BPC6_ARATH | |
|---|---|---|
| UniProt AC | Q8L999 | |
| Protein Name | Protein BASIC PENTACYSTEINE6 | |
| Gene Name | BPC6 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 342 | |
| Subcellular Localization | Nucleus . Nucleus, nucleolus . | |
| Protein Description | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.. | |
| Protein Sequence | MDDGGHRENGRHKAAVQGQWLMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAPAANMSACPPGCQISRGVKHLHHPHMHHHHQQHHIPQLTENAYETREMEPNDGLPTSPPAGSTLESAKPKRGKRVNPKATTQTAANKRGPKNQRKVKKESEDDLNKIMFVKTTHDYTDEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 153 | Phosphorylation | EPNDGLPTSPPAGST CCCCCCCCCCCCCCC | 59.93 | 23776212 | |
| 154 | Phosphorylation | PNDGLPTSPPAGSTL CCCCCCCCCCCCCCC | 27.26 | 23776212 | |
| 159 | Phosphorylation | PTSPPAGSTLESAKP CCCCCCCCCCCCCCC | 31.74 | 23776212 | |
| 160 | Phosphorylation | TSPPAGSTLESAKPK CCCCCCCCCCCCCCC | 33.36 | 23776212 | |
| 163 | Phosphorylation | PAGSTLESAKPKRGK CCCCCCCCCCCCCCC | 44.71 | 23776212 | |
| 197 | Phosphorylation | QRKVKKESEDDLNKI HHHCCCCCHHHHHHH | 56.03 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BPC6_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BPC6_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BPC6_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BPC6_ARATH | BPC6 | physical | 21347358 | |
| BPC1_ARATH | BPC1 | physical | 21347358 | |
| BPC4_ARATH | BPC4 | physical | 21347358 | |
| LHP1_ARATH | TFL2 | physical | 26025051 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
