UniProt ID | BPC6_ARATH | |
---|---|---|
UniProt AC | Q8L999 | |
Protein Name | Protein BASIC PENTACYSTEINE6 | |
Gene Name | BPC6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 342 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . | |
Protein Description | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.. | |
Protein Sequence | MDDGGHRENGRHKAAVQGQWLMQHQPSMKQVMSIIAERDAAIQERNLAISEKKAAVAERDMAFLQRDTAIAERNNAIMERDSALTALQYRENSMVTAPAANMSACPPGCQISRGVKHLHHPHMHHHHQQHHIPQLTENAYETREMEPNDGLPTSPPAGSTLESAKPKRGKRVNPKATTQTAANKRGPKNQRKVKKESEDDLNKIMFVKTTHDYTDEDSSKHILIGSKSDWKSQEMVGLNQVVYDETTMPPPVCSCTGVLRQCYKWGNGGWQSSCCTTTLSMYPLPALPNKRHARVGGRKMSGSAFNKLLSRLAAEGHHDLSNPVDLKDHWAKHGTNRYITIK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
153 | Phosphorylation | EPNDGLPTSPPAGST CCCCCCCCCCCCCCC | 59.93 | 23776212 | |
154 | Phosphorylation | PNDGLPTSPPAGSTL CCCCCCCCCCCCCCC | 27.26 | 23776212 | |
159 | Phosphorylation | PTSPPAGSTLESAKP CCCCCCCCCCCCCCC | 31.74 | 23776212 | |
160 | Phosphorylation | TSPPAGSTLESAKPK CCCCCCCCCCCCCCC | 33.36 | 23776212 | |
163 | Phosphorylation | PAGSTLESAKPKRGK CCCCCCCCCCCCCCC | 44.71 | 23776212 | |
197 | Phosphorylation | QRKVKKESEDDLNKI HHHCCCCCHHHHHHH | 56.03 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BPC6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BPC6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BPC6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BPC6_ARATH | BPC6 | physical | 21347358 | |
BPC1_ARATH | BPC1 | physical | 21347358 | |
BPC4_ARATH | BPC4 | physical | 21347358 | |
LHP1_ARATH | TFL2 | physical | 26025051 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...