dbPTM

BOK_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BOK_HUMAN
UniProt AC	Q9UMX3
Protein Name	Bcl-2-related ovarian killer protein {ECO:0000303\|PubMed:11034351}
Gene Name	BOK {ECO:0000312\|HGNC:HGNC:1087}
Organism	Homo sapiens (Human).
Sequence Length	212
Subcellular Localization	Isoform 1: Mitochondrion membrane Single-pass membrane protein . Endoplasmic reticulum membrane Single-pass membrane protein . Mitochondrion inner membrane . Cytoplasm . Nucleus . Mitochondrion . Endoplasmic reticulum . Mitochondrion outer membrane .
Protein Description	Isoform 1: Apoptosis regulator that functions through different apoptotic signaling pathways. [PubMed: 27076518]
Protein Sequence	MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MEVLRRSSVFAAEI -CCCHHHHHHHHHHH	25.15	30266825
8	Phosphorylation	MEVLRRSSVFAAEIM CCCHHHHHHHHHHHH	21.31	30266825
25	Ubiquitination	FDRSPTDKELVAQAK HCCCCCCHHHHHHHH	56.26	21906983
51	Phosphorylation	LRAGLSWSAPERAAP HHCCCCCCCCCCCCC	30.48	30257219
196	Phosphorylation	WLVAALCSFGRFLKA HHHHHHHHHHHHHHH	31.42	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BOK_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BOK_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BOK_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
B2LA1_HUMAN	BCL2A1	physical	9356461
NOA1_HUMAN	NOA1	physical	21900206

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BOK_HUMAN

Related Literatures of Post-Translational Modification