UniProt ID | BOK_HUMAN | |
---|---|---|
UniProt AC | Q9UMX3 | |
Protein Name | Bcl-2-related ovarian killer protein {ECO:0000303|PubMed:11034351} | |
Gene Name | BOK {ECO:0000312|HGNC:HGNC:1087} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization |
Isoform 1: Mitochondrion membrane Single-pass membrane protein . Endoplasmic reticulum membrane Single-pass membrane protein . Mitochondrion inner membrane . Cytoplasm . Nucleus . Mitochondrion . Endoplasmic reticulum . Mitochondrion outer membrane . |
|
Protein Description | Isoform 1: Apoptosis regulator that functions through different apoptotic signaling pathways. [PubMed: 27076518] | |
Protein Sequence | MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MEVLRRSSVFAAEI -CCCHHHHHHHHHHH | 25.15 | 30266825 | |
8 | Phosphorylation | MEVLRRSSVFAAEIM CCCHHHHHHHHHHHH | 21.31 | 30266825 | |
25 | Ubiquitination | FDRSPTDKELVAQAK HCCCCCCHHHHHHHH | 56.26 | 21906983 | |
51 | Phosphorylation | LRAGLSWSAPERAAP HHCCCCCCCCCCCCC | 30.48 | 30257219 | |
196 | Phosphorylation | WLVAALCSFGRFLKA HHHHHHHHHHHHHHH | 31.42 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOK_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOK_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOK_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
B2LA1_HUMAN | BCL2A1 | physical | 9356461 | |
NOA1_HUMAN | NOA1 | physical | 21900206 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...