| UniProt ID | BH080_ARATH | |
|---|---|---|
| UniProt AC | Q9C8P8 | |
| Protein Name | Transcription factor bHLH80 | |
| Gene Name | BHLH80 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 259 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | ||
| Protein Sequence | MQSTHISGGSSGGGGGGGGEVSRSGLSRIRSAPATWIETLLEEDEEEGLKPNLCLTELLTGNNNSGGVITSRDDSFEFLSSVEQGLYNHHQGGGFHRQNSSPADFLSGSGSGTDGYFSNFGIPANYDYLSTNVDISPTKRSRDMETQFSSQLKEEQMSGGISGMMDMNMDKIFEDSVPCRVRAKRGCATHPRSIAERVRRTRISDRIRRLQELVPNMDKQTNTADMLEEAVEYVKALQSQIQELTEQQKRCKCKPKEEQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 75 | Phosphorylation | VITSRDDSFEFLSSV EEECCCCCCHHHHHH | 30.85 | 27545962 | |
| 80 | Phosphorylation | DDSFEFLSSVEQGLY CCCCHHHHHHHHHCC | 37.34 | 27545962 | |
| 81 | Phosphorylation | DSFEFLSSVEQGLYN CCCHHHHHHHHHCCC | 31.64 | 27545962 | |
| 87 | Phosphorylation | SSVEQGLYNHHQGGG HHHHHHCCCCCCCCC | 21.19 | 27545962 | |
| 136 | Phosphorylation | LSTNVDISPTKRSRD HHCCCCCCCCCCCHH | 23.27 | 19376835 | |
| 149 | Phosphorylation | RDMETQFSSQLKEEQ HHHHHHHHHHHHHHH | 13.83 | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BH080_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BH080_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BH080_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SUMO3_ARATH | SUMO3 | physical | 20855607 | |
| SUMO1_ARATH | SUMO1 | physical | 20855607 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-136, AND MASSSPECTROMETRY. | |