| UniProt ID | BGAT_HUMAN | |
|---|---|---|
| UniProt AC | P16442 | |
| Protein Name | Histo-blood group ABO system transferase | |
| Gene Name | ABO | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 354 | |
| Subcellular Localization |
Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Secreted. Membrane-bound form in trans cisternae of Golgi. Secreted into the body fluid. |
|
| Protein Description | This protein is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal), whereas O individuals lack such activity.. | |
| Protein Sequence | MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 11 | Ubiquitination | VLRTLAGKPKCHALR HHHHHCCCCCCHHHH | 35.38 | - | |
| 46 | Phosphorylation | PRSLMPGSLERGFCM CCCCCCCCCCCCEEE | 22.61 | 22468782 | |
| 65 | Phosphorylation | PDHLQRVSLPRMVYP CCCCCCCCCCCCCCC | 34.54 | 24719451 | |
| 113 | N-linked_Glycosylation | NEQFRLQNTTIGLTV CCCCCCCCCCCCHHH | 43.72 | UniProtKB CARBOHYD | |
| 163 | Phosphorylation | PAAVPRVTLGTGRQL CCCCCEEEECCCCCE | 22.28 | 28555341 | |
| 171 | Phosphorylation | LGTGRQLSVLEVRAY ECCCCCEEEEEHHHH | 19.13 | 28555341 | |
| 178 | Phosphorylation | SVLEVRAYKRWQDVS EEEEHHHHHHHHCHH | 7.19 | 28555341 | |
| 202 | Phosphorylation | FCERRFLSEVDYLVC HHHHHCCCCCCEEEE | 32.63 | 26074081 | |
| 206 | Phosphorylation | RFLSEVDYLVCVDVD HCCCCCCEEEEEECC | 13.25 | 26074081 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BGAT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BGAT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BGAT_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GRM2B_HUMAN | GRAMD3 | physical | 25416956 | |
| TMM79_HUMAN | TMEM79 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...