| UniProt ID | BBX32_ARATH | |
|---|---|---|
| UniProt AC | Q9LJB7 | |
| Protein Name | B-box zinc finger protein 32 {ECO:0000303|PubMed:19920209} | |
| Gene Name | BBX32 {ECO:0000303|PubMed:19920209} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 225 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Repressor of light-mediated regulation of seedling development. Functions by suppressing the activities of positive cofactors like BBX21 and HY5 involved in modulating light-regulated gene expression and growth.. | |
| Protein Sequence | MVSFCELCGAEADLHCAADSAFLCRSCDAKFHASNFLFARHFRRVICPNCKSLTQNFVSGPLLPWPPRTTCCSESSSSSCCSSLDCVSSSELSSTTRDVNRARGRENRVNAKAVAVTVADGIFVNWCGKLGLNRDLTNAVVSYASLALAVETRPRATKRVFLAAAFWFGVKNTTTWQNLKKVEDVTGVSAGMIRAVESKLARAMTQQLRRWRVDSEEGWAENDNV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of BBX32_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BBX32_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BBX32_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BBX32_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| EMF1_ARATH | EMF1 | physical | 21700722 | |
| CDC23_ARATH | APC8 | physical | 21798944 | |
| IND_ARATH | IND | physical | 21798944 | |
| ACBP2_ARATH | ACBP2 | physical | 21798944 | |
| COL5_ARATH | COL5 | physical | 21798944 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...