dbPTM

BBX32_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	BBX32_ARATH
UniProt AC	Q9LJB7
Protein Name	B-box zinc finger protein 32 {ECO:0000303\|PubMed:19920209}
Gene Name	BBX32 {ECO:0000303\|PubMed:19920209}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	225
Subcellular Localization	Nucleus .
Protein Description	Repressor of light-mediated regulation of seedling development. Functions by suppressing the activities of positive cofactors like BBX21 and HY5 involved in modulating light-regulated gene expression and growth..
Protein Sequence	MVSFCELCGAEADLHCAADSAFLCRSCDAKFHASNFLFARHFRRVICPNCKSLTQNFVSGPLLPWPPRTTCCSESSSSSCCSSLDCVSSSELSSTTRDVNRARGRENRVNAKAVAVTVADGIFVNWCGKLGLNRDLTNAVVSYASLALAVETRPRATKRVFLAAAFWFGVKNTTTWQNLKKVEDVTGVSAGMIRAVESKLARAMTQQLRRWRVDSEEGWAENDNV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of BBX32_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of BBX32_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of BBX32_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of BBX32_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EMF1_ARATH	EMF1	physical	21700722
CDC23_ARATH	APC8	physical	21798944
IND_ARATH	IND	physical	21798944
ACBP2_ARATH	ACBP2	physical	21798944
COL5_ARATH	COL5	physical	21798944

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of BBX32_ARATH

Related Literatures of Post-Translational Modification